2. Gene
  3. Ace2 - angiotensin I converting enzyme 2 Gene

Ace2 - angiotensin I converting enzyme 2 Gene

  • Gene
  • Protein
  • Agent
  • Ortholog
Rattus norvegicus
Gene ID: 302668 | Gene type: protein coding

About Ace2

Summary

Enables Carboxypeptidase activity. Involved in maternal process involved in female pregnancy; negative regulation of ERK1 and ERK2 cascade; and negative regulation of smooth muscle cell proliferation. Located in extracellular space and membrane. Used to study glaucoma; myocardial infarction; and thrombosis. Biomarker of hypertension; lung disease; middle cerebral artery infarction; myocardial infarction; and primary biliary cholangitis. Human ortholog(s) of this gene implicated in several diseases, including avian influenza; cerebral malaria; hypertension (multiple); respiratory syncytial virus infectious disease; and severe acute respiratory syndrome. Orthologous to human ACE2 (angiotensin converting Enzyme 2). [provided by Alliance of Genome Resources, Apr 2022]

Ace2 Products(1)

mRNA Protein Name
NM_001012006.2 NP_001012006.1 angiotensin-converting enzyme 2 precursor
Protein Preferred Names Protein Names

angiotensin-converting enzyme 2

ACE-related carboxypeptidase

angiotensin I converting enzyme (peptidyl-dipeptidase A) 2

anigotensin-converting enzyme-related carboxypeptidase

renal angiotensin-converting enzyme 2

Recombinant Ace2 Proteins

Cat. No. Product Name Accession Purity
HY-P72809 ACE2 Protein, Rat (HEK293, His) Q5EGZ1 (Q18-T740) ≥95%

Related Agents

Approval
Bioactive Molecules (4)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-13771 Ursodeoxycholic acid ≥98.0% Unkown
HY-B0260 Methylprednisolone 99.75% Yes
HY-110066 (Z)-Guggulsterone 99.30% Unkown
HY-12404 Diminazene aceturate 99.16% Unkown
Inhibitory Antibodies (2)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P99346 Regdanvimab Inhibitor 95.00% Unkown
HY-P9801 Anti-Spike-RBD mAb / Unkown
Clinical Phase
Bioactive Molecules (1)
Cat. No. Product Name Effect
Purity Phase
HY-19414 MLN-4760 Inhibitor 99.93% Phase 2
Pre-clinical Phase
Bioactive Molecules (49)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-14393 Emodin Inhibitor 99.20% Yes
HY-N0639 Punicalin 99.89% Unkown
HY-15275 BMS-265246 Inhibitor 98.92% Unkown
HY-122445 Resorcinolnaphthalein Activator 99.87% Unkown
HY-P2536 Mca-Ala-Pro-Lys(Dnp)-OH 99.80% Unkown
HY-100450 BML-111 Inhibitor ≥98.0% Unkown
HY-P2222A DX600 TFA Inhibitor 99.94% Unkown
HY-B0260R Methylprednisolone (Standard) 99.67% Unkown
HY-P2222 DX600 Inhibitor 99.93% Unkown
HY-19414A (R)-MLN-4760 Inhibitor 99.51% Unkown
HY-D1270 Direct Violet 1 Inhibitor / Unkown
HY-113478S Ursodeoxycholic acid-2,2,4,4-d4 99.52% Unkown
HY-126419 Kobophenol A Inhibitor 99.90% Unkown
HY-P2616A Mca-YVADAP-Lys(Dnp)-OH TFA Chemical 98.85% Unkown
HY-B0260S3 Methylprednisolone-d7 99.73% Unkown
HY-RS00001 ACE2 Rat Pre-designed siRNA Set A Pre-designed Sets / Unkown
HY-138067 SSAA09E2 Inhibitor / Unkown
HY-P3141 STIEEQAKTFLDKFNHEAEDLFYQSSLASWN 95.28% Unkown
HY-P3142 NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ 96.51% Unkown
HY-157154 MAT-POS-e194df51-1 Inhibitor / Unkown
HY-163943 UNI418 Inhibitor / Unkown
HY-14393S Emodin-d4 Inhibitor / Unkown
HY-121068 Bisoxatin Inhibitor / Unkown
HY-14393R Emodin (Standard) Inhibitor / Unkown
HY-149373 Garcinone B Inhibitor / Unkown
HY-149767 CMX990 Inhibitor / Unkown
HY-151497 Antimicrobial agent-10 Inhibitor / Unkown
HY-151501 Antimicrobial agent-11 Inhibitor / Unkown
HY-151502 Antimicrobial agent-12 Inhibitor / Unkown
HY-151900 SARS-CoV-2 Mpro-IN-4 Inhibitor / Unkown
HY-151901 SARS-CoV-2 Mpro-IN-5 Inhibitor / Unkown
HY-156441 SARS-CoV-2-IN-65 Inhibitor / Unkown
HY-156862 (+)-Chloroquine / Unkown
HY-157966 SARS-CoV-2 3CLpro-IN-23 Inhibitor / Unkown
HY-158073 ML2006a4 Inhibitor / Unkown
HY-161261 SARS-CoV-2-IN-81 Inhibitor / Unkown
HY-B0260S Methylprednisolone-d3 / Unkown
HY-B0260S2 Methylprednisolone-d4 / Unkown
HY-B0260S4 Methylprednisolone-d2 / Unkown
HY-P2616 Mca-YVADAP-Lys(Dnp)-OH Chemical / Unkown
HY-P3258 SP-10 / Unkown
HY-P4546 Abz-Ser-Pro-3-nitro-Tyr / Unkown
HY-P5827 SBP1 peptide / Unkown
HY-RS00152 ACE2 Human Pre-designed siRNA Set A / Unkown
HY-RS00154 ACER2 Human Pre-designed siRNA Set A Pre-designed Sets / Unkown
HY-161070 Antiviral agent 46 Inhibitor / Unkown
HY-162550 Jobosic acid Inhibitor / Unkown
HY-162598 CET-1 Inhibitor / Unkown
HY-W342283 Diminazene / Unkown
Inhibitory Antibodies (1)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P990731 Canvircept / Unkown

Orthologs Information

Species Symbol Source ID
Homo sapiens Ace2 NCBI NCBI:59272
Macaca fascicularis Ace2 NCBI NCBI:102130864
Mus musculus Ace2 NCBI NCBI:70008
Macaca mulatta Ace2 NCBI NCBI:712790