2. Gene
  3. Tat - tyrosine aminotransferase Gene

Tat - tyrosine aminotransferase Gene

  • Gene
  • Protein
  • Agent
  • Ortholog
Rattus norvegicus
Gene ID: 24813 | Gene type: protein coding

About Tat

Summary

Enables L-tyrosine:2-oxoglutarate aminotransferase activity and amino acid binding activity. Involved in several processes, including response to dexamethasone; response to mercury ion; and response to oxidative stress. Located in mitochondrion. Human ortholog(s) of this gene implicated in tyrosinemia and tyrosinemia type II. Orthologous to human TAT (tyrosine aminotransferase). [provided by Alliance of Genome Resources, Apr 2022]

Tat Products(1)

mRNA Protein Name
NM_012668.2 NP_036800.1 tyrosine aminotransferase
Gene Ontology
  • Molecular Function
  • Biological Process
Molecular Function GO Annotation Evidence Reference Source
enables L-tyrosine-2-oxoglutarate transaminase activity IDA
IDA: Inferred from direct assay
12717026 RGD
enables amino acid binding IDA
IDA: Inferred from direct assay
12717026 RGD
Biological Process GO Annotation Evidence Reference Source
involved in amino acid metabolic process IDA
IDA: Inferred from direct assay
12717026 RGD
involved in response to dexamethasone IEP
IEP: Inferred from expression pattern
27856527 RGD
involved in response to glucocorticoid IDA
IDA: Inferred from direct assay
16307467 RGD
involved in response to mercury ion IDA
IDA: Inferred from direct assay
16307467 RGD
involved in response to organic cyclic compound IDA
IDA: Inferred from direct assay
15755314 RGD
involved in response to oxidative stress IDA
IDA: Inferred from direct assay
16335249 RGD
EXP: Inferred from Experiment IDA: Inferred from direct assay IPI: Inferred from physical interaction IMP: Inferred from mutant phenotype IGI: Inferred from genetic interaction IEP: Inferred from expression pattern
Protein Preferred Names Protein Names

tyrosine aminotransferase

L-tyrosine:2-oxoglutarate aminotransferase

Related Agents

Approval
Bioactive Molecules (1)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-B2224 Thiamine disulfide Inhibitor 98.05% Unkown
Clinical Phase
Bioactive Molecules (5)
Cat. No. Product Name Effect
Purity Phase
HY-P0117 Tat-NR2B9c Inhibitor 99.97% Phase 3
HY-142118 Trabedersen Inhibitor 90.45% Phase 3
HY-P4056 CIGB-300 Antagonist / Phase 3
HY-19149 Ro24-7429 99.89% Phase 2
HY-148130 Rugonersen Activator / Phase 1
Pre-clinical Phase
Bioactive Molecules (105)
Cat. No. Product Name Effect
Purity Rare Diseases
HY-P4108 TAT-HA2 Fusion Peptide 99.69% Unkown
HY-P2260 Tat-beclin 1 99.93% Unkown
HY-P5307 Peptide A5K 99.08% Unkown
HY-P2262 TAT-DEF-Elk-1 Inhibitor 99.97% Unkown
HY-P1136B TAT-Gap19 99.47% Unkown
HY-P1136C TAT-Gap19 TFA 99.38% Unkown
HY-P5381 gp91 ds-tat Inhibitor 98.27% Unkown
HY-P0281A TAT TFA 98.40% Unkown
HY-126428 ZL0580 99.26% Unkown
HY-P0282A TAT peptide TFA 99.65% Unkown
HY-P1420 TAT-cyclo-CLLFVY Inhibitor 98.06% Unkown
HY-P1575 TAT (48-57) 98.65% Unkown
HY-P3432 DfTat 98.06% Unkown
HY-P1491 HIV-1 TAT (48-60) 99.80% Unkown
HY-P2280 TAT-P110 Inhibitor 99.87% Unkown
HY-109042 Relacorilant Antagonist 99.12% Yes
HY-P0117A Tat-NR2B9c TFA Inhibitor 99.67% Unkown
HY-P2260C Tat-beclin 1 scrambled TFA 98.54% Unkown
HY-P3429A SAMβA TFA Inhibitor 99.13% Unkown
HY-P2500 (Arg)9, FAM-labeled 99.83% Unkown
HY-P10638 TAT-CN21 Inhibitor 99.90% Unkown
HY-P1801A Cys-TAT(47-57) TFA 98.04% Unkown
HY-P1328 TAT-14 Activator 99.66% Unkown
HY-P2259 TAT-GluA2 3Y Inhibitor 99.95% Unkown
HY-P4106A Tat-GluR23Y, scrambled TFA 99.47% Unkown
HY-P10436 Braftide Inhibitor 99.68% Unkown
HY-P2260B Tat-beclin 1 scrambled 99.01% Unkown
HY-P2307 Tat-NR2Baa 96.89% Unkown
HY-W104477 3-Fluoro-L-tyrosine 99.73% Unkown
HY-P2467 Biotin-TAT (47-57) 99.35% Unkown
HY-P0282 TAT peptide / Unkown
HY-P2262A TAT-DEF-Elk-1 TFA Inhibitor / Unkown
HY-P4114 TAT-NSF700scr 95.17% Unkown
HY-P5117 TAT-CIRP Inhibitor 98.32% Unkown
HY-P5320 TAT-BH4 (Bcl-xL) Inhibitor / Unkown
HY-P5754B TAT-NEP1-40 acetate Inhibitor 94.33% Unkown
HY-P10438 Tat-braftide Inhibitor 99.52% Unkown
HY-115828 APA-APA-MPO dihydrochloride / Unkown
HY-115829 APA-H-MPO hydrochloride / Unkown
HY-148412 Monarsen Inhibitor / Unkown
HY-156372 AChE-IN-44 Inhibitor / Unkown
HY-P10048 TAT-JIP Inhibitor / Unkown
HY-P10049 TAT-TCL1-Akt-in Inhibitor / Unkown
HY-P10074 TAT-MEK1 Inhibitor / Unkown
HY-P10076 TAT-JBD20 Inhibitor / Unkown
HY-P10106 TAT-PAK18 inhibitory peptide Inhibitor / Unkown
HY-P10107 TAT-PAK18 R192A Control / Unkown
HY-P10110 retro-inverso TAT-Beclin 1 (D-amino acid) Inducer / Unkown
HY-P10255 K90-114TAT Inhibitor / Unkown
HY-P10275 Tat-NTS peptide Inhibitor / Unkown
HY-P10357 TAT-CBD3 Inhibitor / Unkown
HY-P10358 TAT-CBD3A6K / Unkown
HY-P10359 TAT-QFNP12 Inhibitor / Unkown
HY-P10360 Tat-βsyn-degron Degrader / Unkown
HY-P10445 TAT-PiET Inhibitor / Unkown
HY-P10446 TAT-PiET-PROTAC Inhibitor / Unkown
HY-P10464 Tat-AKAP79 (326-336) Inhibitor / Unkown
HY-P10465 TRPV1-Tat Antagonist / Unkown
HY-P10797 TAT-N24 Inhibitor / Unkown
HY-P10821 Myr-Tat-PKCβII Inhibitor / Unkown
HY-P10824 RI-OR2-TAT Inhibitor / Unkown
HY-P10839 NBD peptide Inhibitor / Unkown
HY-P10852 TAT-MKK3b Inhibitor / Unkown
HY-P10854 TAT-N15 Inhibitor / Unkown
HY-P1328A TAT-14 TFA Activator / Unkown
HY-P1420A TAT-cyclo-CLLFVY TFA Inhibitor / Unkown
HY-P1575A TAT (48-57) (TFA) / Unkown
HY-P1801 Cys-TAT(47-57) / Unkown
HY-P1908 sgp91 ds-tat Peptide 2, scrambled Inhibitor / Unkown
HY-P2260A Tat-beclin 1 TFA / Unkown
HY-P2298 TAT-P4-(DATC5)2 Inhibitor / Unkown
HY-P2298A TAT-P4-(DATC5)2 TFA / Unkown
HY-P2307A Tat-NR2Baa TFA / Unkown
HY-P2493 (Cys47)-HIV-1 tat Protein (47-57) / Unkown
HY-P3429 SAMβA Inhibitor / Unkown
HY-P3730 Cdk2/Cyclin Inhibitory Peptide I Inhibitor / Unkown
HY-P3731 Cdk2/Cyclin Inhibitory Peptide II Inhibitor / Unkown
HY-P4101 Cys(Npys)-TAT (47-57) / Unkown
HY-P4103 Cys(Npys)-TAT (47-57), FAM-labeled / Unkown
HY-P4105 TAT (47-57), TAMRA-labeled / Unkown
HY-P4106 Tat-GluR23Y, scrambled / Unkown
HY-P4110 TAT-NSF222 Fusion Peptide Inhibitor / Unkown
HY-P4122 TAT (47-57), FAM-labeled / Unkown
HY-P4123 TAT (47-57) GGG-Cys(Npys) / Unkown
HY-P4125 FITC-LC-TAT (47-57) / Unkown
HY-P5277 TAT-GluN2BCTM Degrader / Unkown
HY-P5307A Peptide A5K acetate / Unkown
HY-P5320A TAT-BH4 (Bcl-xL) (TFA) Inhibitor / Unkown
HY-P5384 sgp91 ds-tat Inhibitor / Unkown
HY-P5395 TAT-GluR23A Fusion Peptide Inhibitor / Unkown
HY-P5754 TAT-NEP1-40 Inhibitor / Unkown
HY-P5754A TAT-NEP1-40 TFA Inhibitor / Unkown
HY-P5874 Myr-TAT-CBD3 Inhibitor / Unkown
HY-P5883 TAT-M2NX Inhibitor / Unkown
HY-P5891 TAT-SAMβA Antagonist / Unkown
HY-P5947 Tat-HA-NR2B9c / Unkown
HY-RS14225 TAT Human Pre-designed siRNA Set A Pre-designed Sets / Unkown
HY-10281 YM-60828 methanesulfonate Inhibitor / Unkown
HY-119120 JTK-101 Inhibitor / Unkown
HY-D2441 TAT-PEG-Cy3 / Unkown
HY-P10401 TAT-GluR6-9c Antagonist / Unkown
HY-P10405 TAT-D1 peptide Antagonist / Unkown
HY-P3431 VSGLNPSLWSIFGLQFILLWLVSGSRHYLW Antagonist / Unkown
HY-P3431A VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA Antagonist / Unkown
HY-P0281 TAT / Unkown

Orthologs Information

Species Symbol Source ID
Homo sapiens Tat NCBI NCBI:6898
Canis familiaris Tat NCBI NCBI:479665
Felis catus Tat NCBI NCBI:101080599
Macaca fascicularis Tat NCBI NCBI:102144775
Mus musculus Tat NCBI NCBI:234724
Susscrofa domestica Tat NCBI
Macaca mulatta Tat NCBI NCBI:708005