Search Result
Results for "
TAT peptide
" in MedChemExpress (MCE) Product Catalog:
1
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P0282A
-
|
HIV
|
Infection
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
-
- HY-P4108
-
|
Influenza Virus
|
Infection
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
-
- HY-P0282
-
|
HIV
|
Infection
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
-
- HY-P10275
-
|
Apoptosis
|
Neurological Disease
|
Tat-NTS peptide is a cell-penetrating peptide with neuroprotective effects. Tat-NTS peptide can specifically inhibit the nuclear translocation of ANXA1 and reduce neuronal apoptosis in ischemic areas. Moreover, Tat-NTS peptide can reduce the volume of cerebral ischemic infarction and can be used in the research of ischemic stroke .
|
-
-
- HY-P10106
-
|
PAK
|
Cancer
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
-
-
- HY-P10405
-
|
Dopamine Receptor
|
Neurological Disease
|
TAT-D1 peptide is a selective D1-D2 heterogeneous antagonist. TAT-D1 peptide destroys the heterodimer of the D1-D2 receptor by interacting with the specific domain of the D2 receptor through its unique amino acid sequence, in particular the two glutamate residues at the C terminal of the D1 receptor. TAT-D1 peptide can be used to study the role of D1-D2 receptor heterodimers in the regulation of depressive and anxiety-like behaviors .
|
-
-
- HY-P4101
-
|
HIV
|
Infection
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
|
-
-
- HY-P5395
-
|
HIV
|
Others
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
-
- HY-P5320
-
|
Apoptosis
|
Others
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
-
- HY-P5320A
-
|
Apoptosis
|
Others
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
-
-
- HY-P5307
-
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
|
-
-
- HY-P4125
-
|
HIV
|
Others
|
FITC-LC-TAT (47-57) is a FITC labeled TAT peptide. TAT is a cell-penetrating peptide (CPP). TAT can increase the yields and the solubility of heterologous proteins .
|
-
-
- HY-P10465
-
|
TRP Channel
|
Inflammation/Immunology
|
TRPV1-Tat is an antagonistic peptide that fuses the TRPV1 (transient receptor potential vanilla subtype 1) of the cell-penetrating peptide Tat. TRPV1-Tat blocks this phosphorylation process by competitively binding to the AKAP79 binding site of TRPV1, thereby inhibiting the sensitization of TRPV1. TRPV1-Tat can be used in the study of inflammatory pain .
|
-
-
- HY-P5891
-
|
PKC
|
Cardiovascular Disease
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
-
-
- HY-P0281A
-
|
HIV
|
Infection
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
-
- HY-P0281
-
|
HIV
|
Infection
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
-
- HY-P10074
-
|
ERK
|
Inflammation/Immunology
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
-
-
- HY-P5117
-
|
Toll-like Receptor (TLR)
|
Neurological Disease
|
TAT-CIRP is a a small peptide, refers to Trans-trans-activating (Tat)-cold-inducible RNA binding protein. TAT-CIRP is an inhibitor of myeloid differentiation protein 2 (MD2). TAT-CIRP exhibits robust neuroprotection against ischemic and hemorrhagic stroke in mice .
|
-
-
- HY-P1575
-
|
HIV
|
Infection
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
-
- HY-P10076
-
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
-
- HY-P4106
-
|
Amino Acid Derivatives
|
Neurological Disease
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
-
- HY-P4106A
-
|
Amino Acid Derivatives
|
Neurological Disease
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
-
- HY-P5381
-
|
NADPH Oxidase
|
Others
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
-
-
- HY-P1575A
-
|
HIV
|
Infection
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
|
-
-
- HY-P4122
-
|
HIV
|
Others
|
TAT (47-57), FAM-labeled is a cell-penetrating peptide (CPP). TAT (47-57), FAM-labeled has the potential for intracellular drug delivery research .
|
-
-
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
-
- HY-P1801
-
Cys-[HIV-TAT (47-57)]
|
HIV
|
Infection
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
-
- HY-P1801A
-
Cys-[HIV-TAT (47-57)] TFA
|
HIV
|
Infection
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
-
- HY-P4114
-
|
HIV
|
Others
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
-
- HY-P1328A
-
|
Keap1-Nrf2
|
Others
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
-
- HY-P4123
-
|
HIV
|
Others
|
TAT (47-57) GGG-Cys(Npys) is a cell-penetrating peptide (CPP). TAT (47-57) GGG-Cys(Npys) has the potential for intracellular drug delivery research .
|
-
-
- HY-P4105
-
-
-
- HY-P1136B
-
-
-
- HY-P1136C
-
-
-
- HY-P10446
-
|
Epigenetic Reader Domain
|
Cancer
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445). TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can disrupt the interaction between the breast cancer oncogene BRD4/JMJD6 and inhibit the growth of breast cancer cells. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
-
-
- HY-P5277
-
|
DAPK
|
Neurological Disease
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
-
-
- HY-P2307A
-
|
iGluR
NO Synthase
|
Neurological Disease
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
-
- HY-P2307
-
|
iGluR
NO Synthase
|
Neurological Disease
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
-
- HY-P5754
-
|
Apoptosis
|
Neurological Disease
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
-
- HY-P1491
-
|
HIV
|
Infection
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
-
-
- HY-P10357
-
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
-
-
- HY-P10360
-
|
α-synuclein
|
Neurological Disease
|
Tat-βsyn-degron is an α-synuclein knockdown peptide. Tat-βsyn-degron binds toα-synuclein and reduces α-synuclein levels in primary rat cortical neuron cultures. Tat-βsyn-degron also reduces α-synuclein levels and decreases the parkinsonian toxin-induced neuronal damage and motor impairment in a mouse toxicity model of PD .
|
-
-
- HY-P4103
-
-
-
- HY-P5754A
-
|
Apoptosis
|
Neurological Disease
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
-
- HY-P10438
-
|
Raf
|
Cancer
|
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
-
-
- HY-P10358
-
|
Calcium Channel
|
Neurological Disease
|
TAT-CBD3A6K, is a modified TAT-CBD3 peptide. TAT-CBD3A6K reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
-
-
- HY-P2259
-
|
iGluR
|
Neurological Disease
|
TAT-GluA2 3Y, an interference peptide, blocks long-term depression (LTD) at glutamatergic synapses by disrupting the endocytosis of AMPAR. TAT-GluA2 3Y can alleviate Pentobarbital-induced spatial memory deficits and synaptic depression .
|
-
-
- HY-P3429
-
|
PKC
|
Cardiovascular Disease
|
SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
-
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
-
- HY-P10110
-
|
Autophagy
|
Neurological Disease
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
-
- HY-P4056
-
P15-TAT
|
Casein Kinase
|
Cancer
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
-
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
-
- HY-P3429A
-
|
PKC
|
Cardiovascular Disease
|
SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P10464
-
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P3730
-
|
CDK
|
Cancer
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
- HY-P3731
-
|
CDK
|
Cancer
|
Cdk2/Cyclin Inhibitory Peptide II (Tat-LDL), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
-
- HY-P10445
-
|
Epigenetic Reader Domain
|
Cancer
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4 that disrupts the BRD4/JMJD6 interaction. BRD4/JMJD6 is a protein complex that is critical for oncogene expression and breast cancer, and TAT-PiET inhibits BRD4/JMJD6 target gene expression and breast cancer cell growth. TAT-PiET also resists endocrine resistance in ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
-
- HY-P2260
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
- HY-P2260A
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
- HY-P2280
-
-
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P0282A
-
|
HIV
|
Infection
|
TAT peptide (TFA) is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-P5118A
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P4108
-
|
Influenza Virus
|
Infection
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
- HY-P0282
-
|
HIV
|
Infection
|
TAT peptide is a cell penetrating peptide (GRKKRRQRRRPQ) derived from the trans-activating transcriptional activator (Tat) from HIV-1 .
|
-
- HY-P5118
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P5119
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P5119A
-
|
Peptides
|
Neurological Disease
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P10275
-
|
Apoptosis
|
Neurological Disease
|
Tat-NTS peptide is a cell-penetrating peptide with neuroprotective effects. Tat-NTS peptide can specifically inhibit the nuclear translocation of ANXA1 and reduce neuronal apoptosis in ischemic areas. Moreover, Tat-NTS peptide can reduce the volume of cerebral ischemic infarction and can be used in the research of ischemic stroke .
|
-
- HY-P10106
-
|
PAK
|
Cancer
|
TAT-PAK18 inhibitory peptide is a membrane-permeable PAK inhibitory peptide. TAT-PAK18 inhibitory peptide reduces F-actin clusters and occludes the effect of Shank3 knockdown .
|
-
- HY-P4110
-
|
Peptides
|
Metabolic Disease
Inflammation/Immunology
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
-
- HY-P1908
-
-
- HY-P4113
-
|
Peptides
|
Neurological Disease
|
TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly .
|
-
- HY-P10405
-
|
Dopamine Receptor
|
Neurological Disease
|
TAT-D1 peptide is a selective D1-D2 heterogeneous antagonist. TAT-D1 peptide destroys the heterodimer of the D1-D2 receptor by interacting with the specific domain of the D2 receptor through its unique amino acid sequence, in particular the two glutamate residues at the C terminal of the D1 receptor. TAT-D1 peptide can be used to study the role of D1-D2 receptor heterodimers in the regulation of depressive and anxiety-like behaviors .
|
-
- HY-P4101
-
|
HIV
|
Infection
|
Cys(Npys)-TAT (47-57) is a peptide fragment of TAT peptide and it is able to interact with plasmid DNA electrostatically. Cys(Npys)-TAT (47-57) is corresponding to the transduction domain of TAT with an activated cysteine residue C. TAT is a small nuclear transcriptional activator protein encoded by HIV-1 .
|
-
- HY-P5395
-
|
HIV
|
Others
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P5307A
-
INF7-A5K-TAT aceTATe
|
Peptides
|
Cancer
|
Peptide A5K (INF7-A5K-TAT acetate) acetate is a INF7-TAT derivative and is used for CRISPR RNP delivery into T cells. Peptide A5K acetate effectively promotes the delivery of Cas9 RNP to natural killer (NK) cells .
|
-
- HY-P5405
-
Transducible TAT-HA fusogenic peptide
|
Peptides
|
Others
|
dTAT-HA2 enhances TAT-Cre escape from macropinosomes. dTAT-HA2 is a transfusible, pH-sensitive, fusogenic peptide .
|
-
- HY-P5320
-
|
Apoptosis
|
Others
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P5320A
-
|
Apoptosis
|
Others
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P5307
-
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
|
-
- HY-P10324
-
p16INK4a peptide
|
Peptides
|
Cancer
|
TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex .
|
-
- HY-P4125
-
|
HIV
|
Others
|
FITC-LC-TAT (47-57) is a FITC labeled TAT peptide. TAT is a cell-penetrating peptide (CPP). TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P5384
-
|
Peptides
|
Others
|
sgp91 ds-tat is a biological active peptide. (This is a scrambled control peptide for gp91 ds-tat.)
|
-
- HY-P10465
-
|
TRP Channel
|
Inflammation/Immunology
|
TRPV1-Tat is an antagonistic peptide that fuses the TRPV1 (transient receptor potential vanilla subtype 1) of the cell-penetrating peptide Tat. TRPV1-Tat blocks this phosphorylation process by competitively binding to the AKAP79 binding site of TRPV1, thereby inhibiting the sensitization of TRPV1. TRPV1-Tat can be used in the study of inflammatory pain .
|
-
- HY-P5891
-
|
PKC
|
Cardiovascular Disease
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
-
- HY-P4112
-
|
Peptides
|
Others
|
TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr Fusion Polypeptide, scrambled is consisted of the intact TAT domain followed by the amino acid residues of NSF 222-243 in a scrambled order .
|
-
- HY-P0281A
-
|
HIV
|
Infection
|
TAT TFA (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P0281
-
|
HIV
|
Infection
|
TAT (YGRKKRRQRRR) is derived from the transactivator of transcription (TAT) of human immunodeficiency virus-1 (HIV-1) and is a cell-penetrating peptide. TAT can increase the yields and the solubility of heterologous proteins .
|
-
- HY-P10074
-
|
ERK
|
Inflammation/Immunology
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
-
- HY-P5117
-
|
Toll-like Receptor (TLR)
|
Neurological Disease
|
TAT-CIRP is a a small peptide, refers to Trans-trans-activating (Tat)-cold-inducible RNA binding protein. TAT-CIRP is an inhibitor of myeloid differentiation protein 2 (MD2). TAT-CIRP exhibits robust neuroprotection against ischemic and hemorrhagic stroke in mice .
|
-
- HY-P1575
-
|
HIV
|
Infection
|
TAT (48-57) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57.
|
-
- HY-P10076
-
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
- HY-P4106
-
|
Amino Acid Derivatives
|
Neurological Disease
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P4106A
-
|
Amino Acid Derivatives
|
Neurological Disease
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P10107
-
|
Peptides
|
Others
|
TAT-PAK18 R192A is an inactive Tat-Pak peptide. TAT-PAK18 R192A does not have any effect in the translocation of Rac1 triggered by any of the interrogated proteins .
|
-
- HY-P5381
-
|
NADPH Oxidase
|
Others
|
gp91 ds-tat is a biological active peptide. (NADPH oxidase assembly peptide inhibitor)
|
-
- HY-P5281
-
-
- HY-P1575A
-
|
HIV
|
Infection
|
TAT (48-57) (TFA) is a cell-permeable peptide, derived from HIV-1 transactivator of transcription (Tat) protein residue 48-57 .
|
-
- HY-P4122
-
|
HIV
|
Others
|
TAT (47-57), FAM-labeled is a cell-penetrating peptide (CPP). TAT (47-57), FAM-labeled has the potential for intracellular drug delivery research .
|
-
- HY-P1328
-
TAT-14
1 Publications Verification
|
Keap1-Nrf2
|
Others
|
TAT-14 is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P1801
-
Cys-[HIV-TAT (47-57)]
|
HIV
|
Infection
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P1801A
-
Cys-[HIV-TAT (47-57)] TFA
|
HIV
|
Infection
|
Cys-TAT(47-57) (Cys-[HIV-Tat (47-57)]) is an arginine rich cell penetrating peptide derived from the HIV-1 transactivating protein.
|
-
- HY-P4114
-
|
HIV
|
Others
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
- HY-P1328A
-
|
Keap1-Nrf2
|
Others
|
TAT-14 TFA is a 14-mer peptide that acts as Nrf2 activator with an anti-inflammatory effect. TAT-14 TFA has no effect on Nrf2 mRNA expression, but increases Nrf2 protein level due to targeting the Nrf2 binding site on Keap1 .
|
-
- HY-P4123
-
|
HIV
|
Others
|
TAT (47-57) GGG-Cys(Npys) is a cell-penetrating peptide (CPP). TAT (47-57) GGG-Cys(Npys) has the potential for intracellular drug delivery research .
|
-
- HY-P4105
-
-
- HY-P2193
-
|
Peptides
|
Infection
|
TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
-
- HY-P1136B
-
-
- HY-P2193A
-
|
Peptides
|
Infection
|
TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
-
- HY-P1136C
-
- HY-P10446
-
|
Epigenetic Reader Domain
|
Cancer
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445). TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can disrupt the interaction between the breast cancer oncogene BRD4/JMJD6 and inhibit the growth of breast cancer cells. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
- HY-P5277
-
|
DAPK
|
Neurological Disease
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
- HY-P2307A
-
|
iGluR
NO Synthase
|
Neurological Disease
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P2307
-
|
iGluR
NO Synthase
|
Neurological Disease
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P5754
-
|
Apoptosis
|
Neurological Disease
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P1491
-
|
HIV
|
Infection
|
HIV-1 TAT (48-60) is a cell-penetrating peptide derived from the human immunodeficient virus (HIV)-1 Tat protein residue 48-60. It has been used to deliver exogenous macromolecules into cells in a non-disruptive way.
|
- HY-P10357
-
|
HIV
iGluR
|
Infection
Inflammation/Immunology
|
TAT-CBD3, a 15-amino acid peptide from CRMP2, fused to the TAT cell-penetrating motif of the HIV-1 protein, disrupts CRMP2-NMDAR interaction without change in NMDAR localization .
|
- HY-P10360
-
|
α-synuclein
|
Neurological Disease
|
Tat-βsyn-degron is an α-synuclein knockdown peptide. Tat-βsyn-degron binds toα-synuclein and reduces α-synuclein levels in primary rat cortical neuron cultures. Tat-βsyn-degron also reduces α-synuclein levels and decreases the parkinsonian toxin-induced neuronal damage and motor impairment in a mouse toxicity model of PD .
|
- HY-P4103
-
- HY-P5754A
-
|
Apoptosis
|
Neurological Disease
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P10438
-
|
Raf
|
Cancer
|
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
- HY-P10358
-
|
Calcium Channel
|
Neurological Disease
|
TAT-CBD3A6K, is a modified TAT-CBD3 peptide. TAT-CBD3A6K reduces T- and R-type voltage-dependent calcium currents in dorsal root ganglion (DRG) neurons. TAT-CBD3A6K shows anti-nociceptive effects in a model of AIDS-induced peripheral neuropathy by preventing CRMP-2-mediated enhancement of T- and R-type calcium channel function .
|
- HY-P2259
-
|
iGluR
|
Neurological Disease
|
TAT-GluA2 3Y, an interference peptide, blocks long-term depression (LTD) at glutamatergic synapses by disrupting the endocytosis of AMPAR. TAT-GluA2 3Y can alleviate Pentobarbital-induced spatial memory deficits and synaptic depression .
|
- HY-P3429
-
|
PKC
|
Cardiovascular Disease
|
SAMβA is conjugated to the cell permeable peptide TAT47-57. SAMβA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
- HY-P1420
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P10110
-
|
Autophagy
|
Neurological Disease
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
- HY-P4056
-
P15-TAT
|
Casein Kinase
|
Cancer
|
CIGB-300 (P15-Tat) is an anti-casein kinase 2 (CK2) peptide that exhibits anticancer properties by interfering with the phosphorylation of protein kinase CK2. CIGB-300 induces apoptosis in multiple tumor cell lines and can be used in cancer research .
|
- HY-P2298
-
|
Peptides
|
Neurological Disease
|
TAT-P4-(DATC5)2 is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 can inhibit addiction in rats .
|
- HY-P1420A
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
TAT-cyclo-CLLFVY TFA is a cyclic peptide inhibitor of HIF-1 heterodimerization that inhibits hypoxia signaling in cancer cells. TAT-cyclo-CLLFVY TFA disrupts HIF-1α/HIF-1β protein-protein interaction with an IC50 of 1.3 μM .
|
- HY-P3432
-
|
Peptides
|
Others
|
DfTat is a dimer of the prototypical cell-penetrating peptide TAT. DfTat can deliver small molecules, peptides and proteins into live cells with a particularly high efficiency. DfTat labeled with the rhodamine can be used as a tracer for easy detection .
|
- HY-P3429A
-
|
PKC
|
Cardiovascular Disease
|
SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
- HY-P2298A
-
|
Peptides
|
Neurological Disease
|
TAT-P4-(DATC5)2 TFA is a high-affinity peptide inhibitor of the PICK1 (protein interacting with C kinase-1) PDZ domain, with a Ki of 1.7 nM. TAT-P4-(DATC5)2 TFA can inhibit addiction in rats .
|
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
- HY-P10464
-
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
- HY-P3730
-
|
CDK
|
Cancer
|
Cdk2/Cyclin Inhibitory Peptide I (Tat-LFG), a CDK2 inhibitor, kills U2OS osteosarcoma cells in a dose-dependent manner .
|
- HY-P2262
-
TDE
|
Peptides
|
Neurological Disease
|
TAT-DEF-Elk-1 (TDE) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity .
|
- HY-P2500
-
|
Peptides
|
Others
|
(Arg)9, FAM-labeled, a cell-penetrating peptide (CPP), is a nona-arginine (ARG) with FAM label. CPPs have emerged as powerful tools for delivering bioactive cargoes into the cytosol of intact cells .
|
- HY-P10445
-
|
Epigenetic Reader Domain
|
Cancer
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4 that disrupts the BRD4/JMJD6 interaction. BRD4/JMJD6 is a protein complex that is critical for oncogene expression and breast cancer, and TAT-PiET inhibits BRD4/JMJD6 target gene expression and breast cancer cell growth. TAT-PiET also resists endocrine resistance in ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
- HY-P2262A
-
TDE TFA
|
Peptides
|
Neurological Disease
|
TAT-DEF-Elk-1 TFA (TDE TFA) is a cell-penetrating peptide inhibitor of Elk-1, mimics and specifically interferes with the DEF domain of Elk-1. TAT-DEF-Elk-1 TFA blocks Elk-1 phosphorylation and prevents Elk-1 nuclear translocation without interfering with ERK nor MSK1 activation. TAT-DEF-Elk-1 TFA is a useful tool to analyze the role of Elk-1 in this process during the development of neuronal plasticity .
|
- HY-P2260
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P2260A
-
|
Autophagy
HIV
|
Infection
|
Tat-beclin 1 TFA, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 TFA decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P2280
-
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-P10324
-
|
TAT-p16 (p16INK4a peptide) is a peptide mimic of p16INK4a that can induce an early G phase cell cycle arrest in the absence of active cyclin E:Cdk2 complex .
|
-
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: