Search Result

Pathways Recommended:	Metabolic Enzyme/Protease

Results for "

enzymic peptide

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin-converting Enzyme (ACE) (24) Amino Acid Derivatives (2) Aminoacyl-tRNA Synthetase (1) Aminopeptidase (2) Angiotensin Receptor (7) Apoptosis (3) Beta-secretase (1) Biochemical Assay Reagents (12) Btk (1) Casein Kinase (1) Caspase (4) CDK (1) Cholinesterase (ChE) (1) Cytochrome P450 (2) Drug Derivative (1) Drug Intermediate (1) Endogenous Metabolite (8) Factor XI (1) Fluorescent Dye (5) Fungal (2) Furin (2) GCGR (2) Glycosidase (1) Histone Demethylase (1) Microtubule/Tubulin (1) MMP (4) Myosin (1) Neprilysin (3) Opioid Receptor (2) PKA (1) Platelet-activating Factor Receptor (PAFR) (1) Proteasome (1) Secretin Receptor (2) Ser/Thr Protease (2) Thrombin (1)
By Research Areas:	Cancer (8) Cardiovascular Disease (25) Endocrinology (5) Infection (10) Inflammation/Immunology (9) Metabolic Disease (17) Neurological Disease (9)
Click Chemistry:	Azide (1)
Oligonucleotides:	Nucleotides and their Analogs (1)

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

Natural
Products

Click Chemistry

Oligonucleotides

Targets Recommended: Formyl Peptide Receptor (FPR) Peptide-Drug Conjugates (PDCs) Natriuretic Peptide Receptor (NPR) Proteolytic Enzyme CGRP Receptor Amyloid-β Angiotensin-converting Enzyme (ACE) NEDD8-activating Enzyme Endothelin-converting enzyme (ECE) E1/E2/E3 Enzyme

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-W090942

Z-Gly-Gly-Phe-OH	Amino Acid Derivatives	Others
Z-Gly-Gly-Phe-OH is an active compound. Z-Gly-Gly-Phe-OH can be used for the synthesis of enzymic peptide .

HY-O0004

Collagenase I, from Clostridium histolyticum	MMP	Metabolic Disease
Collagenases are enzymes that break the peptide bonds in collagen. Collagenases are derived from the Clostridium histolyticum. Collagenases (Type I) are proteolytic enzymes that break peptide bonds in collagen and can be used for tissue digestion and dissociation.

HY-E70017

Peptidase, microorganism Erepsin; Peptidase (IMPa)	Others	Others
Peptidase (IMPa) (Erepsin) is catalytically active enzyme that cleaves peptide bonds in proteins and peptides by hydrolysis .

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the *angiotensin converting enzyme* 2** .

HY-W927376

Boc-Val-Arg-AMC	Fluorescent Dye	Others
Boc-Val-Arg-AMC is a synthetic peptide compound. As a specific fluorescent substrate, Boc-Val-Arg-AMC can be specifically cleaved by specific enzymes, especially thrombin, to release a fluorescent molecule AMC (7-amino-4-methylcoumarin), which can be used to monitor thrombin activity. Boc-Val-Arg-AMC can be used to detect thrombin activity in plasma samples .

HY-P10679

GPLGLAGGWGERDGS	MMP	Cancer
GPLGLAGGWGERDGS is a peptide with MMP enzyme responsiveness and tumor targeting function, which can be used to monitor enzyme-guided nanoparticle assembly in tumors .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-E70421

Butelase 1 ligase	Angiotensin Receptor	Others
Butelase 1 ligase can be used for the cyclization of food-derived angiotensin I converting enzyme (ACE) inhibitory peptides, and thus improves the stability and bioactivity of ACE inhibitory peptides .

HY-150226

Enzyme-IN-1	Proteasome	Inflammation/Immunology
Enzyme-IN-1 (compound 1) is a peptide-based inhibitor of N-terminal nucleophile (Ntn) hydrolases. Specifically, Enzyme-IN-1 inhibits the chymotrypsin-like activity (CT-L) of the 20S proteasome. Enzyme-IN-1 may has potential antiinflammatory properties .

HY-W098322

Z-Lys-OMe hydrochloride	Drug Intermediate	Others
Z-Lys-OMe hydrochloride is a synthetic intermediate that can be used in the synthesis of peptide enzyme substrates and lysine cationic surfactants.

HY-P1032

Angiotensin I (human, mouse, rat) 2 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P3118

Bz-IEGR-pNA acetate	Biochemical Assay Reagents	Others
Bz-IEGR-pNA acetate is a trypsin substrate that can be hydrolyzed by prostate kinase release enzyme-related peptide KLKs .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-E70375

Fructosyl-peptide oxidase (FPOX-CE) Fructosyl-peptide: oxygen oxidoreductase	Others	Others
Fructosyl-peptide oxidase (FPOX-CE) (Fructosyl-peptide: oxygen oxidoreductase) is an enzyme that catalyzes the oxidation of glycopeptides. Fructosyl-peptide oxidase (FPOX-CE) shows high activity against small molecule glycated peptides, but no activity is detected against the glycated hexapeptide standard fVHLTPE used in the study. Fructosyl-peptide oxidase (FPOX-CE) can be used in the study of diabetes monitoring .

HY-U00171

SQ28603 SQ28,603; Squibb 28603	Neprilysin	Metabolic Disease
SQ28603 is a potent and selective inhibitor of neutral endopeptidase 3.4.24.11 (NEP), an enzyme that degrades atrial natriuretic peptide (ANP).

HY-P1244

Secretin (33-59), rat Secretin (rat)	Secretin Receptor	Neurological Disease
Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K ⁺ from the pancreas.

HY-138126A

Dansyl-Tyr-Val-Gly TFA	Others	Neurological Disease
Dansyl-Tyr-Val-Gly TFA is a substrate of peptidylglycine monooxygenase (PHM). Peptidylglycine monooxygenase is an essential enzyme for the posttranslational amidation of neuroendocrine peptides .

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P2480

Histone H1-derived Peptide	CDK	Others
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific *angiotensin-converting enzyme* (ACE)** inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P1244A

Secretin (33-59), rat TFA Secretin (rat) (TFA)	Secretin Receptor	Neurological Disease
Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K ⁺ from the pancreas .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P10346

smMLCK peptide Smooth-Muscle Myosin Light-Chain Kinase (796-815)	Myosin	Cardiovascular Disease Inflammation/Immunology
smMLCK peptide is a specific inhibitor of smooth muscle myosin light chain kinase (smMLCK). The smMLCK peptide mimics the substrate and competitively inhibits the binding of the actual substrate to the enzyme, thereby inhibiting the kinase activity. This inhibition prevents the phosphorylation of the myosin light chain, thus inhibiting muscle contraction .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent *angiotensin-converting enzyme* (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-18211

CGS 35601	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
CGS 35601 is the inhibitor for endothelin-converting enzyme-1 (ECE-1), neutral endopeptidase 24.11 (NEP), and angiotensin-converting enzyme (ACE), with IC₅₀s of 55, 2, and 22 nM, respectively. CGS 35601 suppresses the big endothelin-1 (big ET-1)- and angiotensin I-induced pressor response, and enhances circulation of atrial natriuretic peptide (ANP), regulates the cardiovascular function in SD rats .

HY-131618

Hippuryl-Arg Bz-Gly-Arg	Amino Acid Derivatives	Others
Hippuryl-Arg (Bz-Gly-Arg) is a substrate used for fluorescence detection and is commonly used in biochemical studies, especially in studying enzyme activity. The phenylalanine portion of Hippuryl-Arg is connected by an aromatic side chain, which allows it to be detected under ultraviolet light. Hippuryl-Arg is used to detect enzymes that recognize and cut peptide bonds containing arginine .

HY-112862

Arg-AMS	Aminoacyl-tRNA Synthetase	Infection
Arg-AMS (compound 24) is a potent nanomolar inhibitor of arginyl tRNA synthetase, which displays tightly bound inhibitory characteristics for the A-domains in non-ribosomal peptide synthetases (NRPS) enzymes .

HY-118060

Dipeptide 2 N-Valyltryptophan; Val-Trp	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Dipeptide 2 (N-Valyltryptophan; Val-Trp) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient . Dipeptide 2 is an *angiotensin-converting Enzyme* (ACE)** .

HY-E70453

Human prostate transglutaminase Prostate Transglutaminase; TG4; TGase 4	Biochemical Assay Reagents	Metabolic Disease
Human prostate transglutaminase (TG4; TGase 4) is an enzyme that mediates the transfer of acyl groups from glutamine residues in proteins or peptides to primary amines and belongs to the prostate transglutaminase protein family. Human prostate transglutaminase forms an ε-(γ-glutamyl)lysine bond between proteins by transferring the acyl group of a peptide-bound glutamine residue to the primary amino group of a peptide-bound lysine residue .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .

HY-P3904

P34cdc2 Kinase Substrate Peptide	Biochemical Assay Reagents	Others
P34cdc2 Kinase Substrate Peptide is a synthetic peptide substrates for P34 ^cdc2 kinase, with a K_m of 74 μM for the purified human enzyme. P34cdc2 Kinase Substrate Peptide can be used in a rapid assay of P34 ^cdc2 phosphorylation in vitro. P34 ^cdc2, a protein serinehhreonine kinase, is a cell division cycle-regulated protein kinase .

HY-E70012

Penicillinase	Endogenous Metabolite	Infection Metabolic Disease
Penicillinase is a beta-lactamase. beta-lactamase enzymes inactivate beta-lactam antibiotics by hydrolyzing the peptide bond of the characteristic four-membered beta-lactam ring rendering the antibiotic ineffective .

HY-P1141

GLP-1(9-36)amide	GCGR	Metabolic Disease
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor .

HY-P3748

Casein Kinase II Receptor Peptide	Casein Kinase	Others
Casein Kinase II Receptor Peptide is a substrate for casein kinase II with an K_m value of 500 µM. Casein Kinase II Substrate can be used for measure casein kinase II activity in crude enzyme preparations .

HY-116126

Leuhistin	Aminopeptidase	Cancer
Leuhistin is an AP-M (aminopeptidase-M) inhibitor. AP-M is an inactivating enzyme of bioactive peptides in cerebral membranes. Leuhistin can be produced by Bacillus laterosporus BMI156-14F1 .

HY-P10791

YYLLVR	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
YYLLVR is an angiotensin-converting enzyme (ACE) inhibitory peptide with an inhibitory rate of 89.10%. YYLLVR has a lower binding energy for ACE of -35.98 kcal/mol. YYLLVR can be used in the study of hypertensive diseases .

HY-P1141A

GLP-1(9-36)amide TFA	GCGR	Metabolic Disease
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor .

HY-137872

L-Leucyl-4-nitroanilide hydrochloride	Biochemical Assay Reagents	Others
L-Leucyl-4-nitroanilide hydrochloride is a commonly used substrate in various biochemical assays to measure the activity of enzymes that cleave peptide bonds, such as proteases. L-Leucine p-nitroanilide hydrochloride has unique chemical properties that allow it to be cleaved by these enzymes to form a yellow product called p-nitroaniline. This makes it a useful tool for detecting and quantifying protease activity in biological samples such as blood or tissue extracts.

HY-P10173

Abz-LFK(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .

HY-129225

WRR139	Others	Cancer
WRR139 is a peptide vinyl sulfone involving in disease processes such as inflammation and cancer. WRR139 is also a *cytosolic enzyme* N-glycanase 1 (NGLY1) and Nrf1** inhibitor. WRR139 enhances Carfilzomib cytotoxicity against cancer cells .

HY-P3632

[DAla2, DArg6] Dynorphin A, (1-13) (porcine) DADAD	Opioid Receptor	Neurological Disease Metabolic Disease
[DAla2, DArg6] Dynorphin A, (1-13) (porcine) (DADAD) is an opioid peptide (dynorphinl-13, DYN) derivative found in porcine pituitary extracts. DYN is highly potent at the peripheral opioid receptors GPI and MVD, but is readily and rapidly degraded in vivo. [DAla2, DArg6] Dynorphin A, (1-13) (porcine) has some resistance to enzymatic cleavage and prevents peptide cleavage by enzymes .

HY-Y0623

N-Hydroxysuccinimide HOSu; 1-Hydroxy-2,5-pyrrolidinedione	Biochemical Assay Reagents	Others
N-Hydroxysuccinimide (HOSu; 1-Hydroxy-2,5-pyrrolidinedione) is an activated ester commonly used in bioconjugation technologies such as protein labeling with fluorescent dyes and enzymes, chromatography supports, beads, nanoparticles, and microarrays Surface activation of glass slides, and chemically synthesized peptides .

HY-125564

Acetyltrialanine	Aminopeptidase	Others
Acetyltrialanine is a peptide containing three amino acid residues in which the N-terminal amino acid is acetylated and used as a substrate for Nα-acetyl alanine aminopeptidase in order to study the activity and properties of the enzyme. Acetyltrialanine can be used in the study of protein degradation and N-terminal regulation .

HY-125341

Microginin 527	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Microginin 527 is a linear cyanobacterial peptide with potent angiotensin-converting enzyme (ACE) inhibitory activity. Microginin 527 also exhibits inhibitory effects on protein phosphatases and leucine aminopeptidase. With an IC50 value of 31 μM, Microginin 527 is the most active component in this class of compounds .

HY-120833

Ac-Ile-Glu-Thr-Asp-pNA	Caspase	Others
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .

HY-P2980

Carboxypeptidase A, Bovine pancreas EC 3.4.2.1	Endogenous Metabolite	Others
Carboxypeptidase A, Bovine pancreas (EC 3.4.2.1) is a zinc-containing metalloprotease, is often used in biochemical studies. Carboxypeptidase A catalyzes the hydrolysis of the peptide bonds that are adjacent to the C-terminal end of a polypeptide chain. Carboxypeptidase A is a prototypical enzyme for metalloproteases that plays important roles in biological systems .

Cat. No.	Product Name	Type

HY-Y0623

N-Hydroxysuccinimide HOSu; 1-Hydroxy-2,5-pyrrolidinedione	Biochemical Assay Reagents
N-Hydroxysuccinimide (HOSu; 1-Hydroxy-2,5-pyrrolidinedione) is an activated ester commonly used in bioconjugation technologies such as protein labeling with fluorescent dyes and enzymes, chromatography supports, beads, nanoparticles, and microarrays Surface activation of glass slides, and chemically synthesized peptides .

HY-W133898

Tryptone

Microbial Culture

Tryptone is a common component of biological media. Tryptone is the polypeptone derived from the protein hydrolysis of animal tissue (pancreas) and digested by pancreatic enzymes. The main components of Tryptone were the digestion of casein by trypsin, including the peptones, small peptides and amino acids generated from the hydrolysis of casein. Tryptone provides nutrients needed for bacterial growth, especially nitrogen and carbon sources.

HY-114365

UDP-GalNAc disodium UDP-N-acetyl-D-galactosamine disodium	Gene Sequencing and Synthesis
UDP-GalNAc (UDP-N-acetyl-D-galactosamine) disodium is a sugar nucleotide and a substrate of EpsC115. EpsC115 is an exopolymeric substances (EPS) N-terminal deletion mutant with the residue 1-115 deletion. UDP-GalNAc UDP-GalNAc is the donor substrate of many N-acetylgalactosaminyltransferases, enzymes which transfer GalNAc from the nucleotide sugar to a saccharide or peptide acceptor .

HY-137872

L-Leucyl-4-nitroanilide hydrochloride

Enzyme Substrates

L-Leucyl-4-nitroanilide hydrochloride is a commonly used substrate in various biochemical assays to measure the activity of enzymes that cleave peptide bonds, such as proteases. L-Leucine p-nitroanilide hydrochloride has unique chemical properties that allow it to be cleaved by these enzymes to form a yellow product called p-nitroaniline. This makes it a useful tool for detecting and quantifying protease activity in biological samples such as blood or tissue extracts.

Cat. No.	Product Name	Target	Research Area

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P2509

Histone H2A (1-20)	Peptides	Others
Histone H2A (1-20), a 35-residue a peptide of histone H2A, is a substrate for methyltransferase/demethylase enzymes .

HY-P1032

Angiotensin I (human, mouse, rat) 2 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the *angiotensin converting enzyme* 2** .

HY-P10679

GPLGLAGGWGERDGS	MMP	Cancer
GPLGLAGGWGERDGS is a peptide with MMP enzyme responsiveness and tumor targeting function, which can be used to monitor enzyme-guided nanoparticle assembly in tumors .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-P10258

KRES peptide	Peptides	Cardiovascular Disease Inflammation/Immunology
KRES peptide is an apolipoprotein with 4 amino acid residues. KRES peptide interacts with lipids, reduces lipoprotein lipid hydroperoxides (LOOH), activates antioxidant enzymes associated with high-density lipoprotein. KRES peptide exhibits anti-inflammatory and anti-atherogenic properties. KRES peptide is orally active .

HY-P3118

Bz-IEGR-pNA acetate	Biochemical Assay Reagents	Others
Bz-IEGR-pNA acetate is a trypsin substrate that can be hydrolyzed by prostate kinase release enzyme-related peptide KLKs .

HY-P4349

Pyr-Arg-Thr-Lys-Arg-AMC	Peptides	Others
Pyr-Arg-Thr-Lys-Arg-AMC is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P4349A

Pyr-Arg-Thr-Lys-Arg-AMC TFA	Peptides	Others
Pyr-Arg-Thr-Lys-Arg-AMC TFA is a AMC peptide. AMC is a decapeptide that is specifically hydrolyzed by proteases such as trypsin and thrombin. The AMC peptide can be used to determine the activity of protease and the potency of enzyme inhibitors .

HY-P1244

Secretin (33-59), rat Secretin (rat)	Secretin Receptor	Neurological Disease
Secretin (33-59), rat is a 27-aa peptide, acts on secretin receptor, enhances the secretion of bicarbonate, enzymes, and K ⁺ from the pancreas.

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-W011165

L-Lysyl-L-lysine dihydrochloride Lysyllysine dihydrochloride	Peptides	Others
L-Lysyl-L-lysine (Lysyllysine) dihydrochloride is an enzyme cleavable basic amino acid. L-Lysyl-L-lysine dihydrochloride can be used for delivering multiple biologically active peptides .

HY-P2480

Histone H1-derived Peptide	CDK	Others
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific *angiotensin-converting enzyme* (ACE)** inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P1244A

Secretin (33-59), rat TFA Secretin (rat) (TFA)	Secretin Receptor	Neurological Disease
Secretin (33-59), rat (TFA) is a 27-aa peptide, which acts on secretin receptor, and enhances the secretion of bicarbonate, enzymes, and K ⁺ from the pancreas .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P10346

smMLCK peptide Smooth-Muscle Myosin Light-Chain Kinase (796-815)	Myosin	Cardiovascular Disease Inflammation/Immunology
smMLCK peptide is a specific inhibitor of smooth muscle myosin light chain kinase (smMLCK). The smMLCK peptide mimics the substrate and competitively inhibits the binding of the actual substrate to the enzyme, thereby inhibiting the kinase activity. This inhibition prevents the phosphorylation of the myosin light chain, thus inhibiting muscle contraction .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent *angiotensin-converting enzyme* (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-118060

Dipeptide 2 N-Valyltryptophan; Val-Trp	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Dipeptide 2 (N-Valyltryptophan; Val-Trp) is a bioactive peptide with anti-aging effect and has been reported used as a cosmetic ingredient . Dipeptide 2 is an *angiotensin-converting Enzyme* (ACE)** .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .

HY-P3904

P34cdc2 Kinase Substrate Peptide	Biochemical Assay Reagents	Others
P34cdc2 Kinase Substrate Peptide is a synthetic peptide substrates for P34 ^cdc2 kinase, with a K_m of 74 μM for the purified human enzyme. P34cdc2 Kinase Substrate Peptide can be used in a rapid assay of P34 ^cdc2 phosphorylation in vitro. P34 ^cdc2, a protein serinehhreonine kinase, is a cell division cycle-regulated protein kinase .

HY-P1141

GLP-1(9-36)amide	GCGR	Metabolic Disease
GLP-1(9-36)amide is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide acts as an antagonist to the human pancreatic GLP-1 receptor .

HY-P3748

Casein Kinase II Receptor Peptide	Casein Kinase	Others
Casein Kinase II Receptor Peptide is a substrate for casein kinase II with an K_m value of 500 µM. Casein Kinase II Substrate can be used for measure casein kinase II activity in crude enzyme preparations .

HY-P10791

YYLLVR	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
YYLLVR is an angiotensin-converting enzyme (ACE) inhibitory peptide with an inhibitory rate of 89.10%. YYLLVR has a lower binding energy for ACE of -35.98 kcal/mol. YYLLVR can be used in the study of hypertensive diseases .

HY-P1141A

GLP-1(9-36)amide TFA	GCGR	Metabolic Disease
GLP-1(9-36)amide TFA is a major metabolite of glucagon-like peptide-1-(7-36) amide formed by the enzyme dipeptidyl peptidase-4 (DPP-4). GLP-1(9-36)amide TFA acts as an antagonist to the human pancreatic GLP-1 receptor .

HY-P10173

Abz-LFK(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .

HY-P5528

2Abz-SLGRKIQIK(Dnp)-NH2	Peptides	Others
2Abz-SLGRKIQIK(Dnp)-NH2 is a biological active peptide. (This peptide is a second complement component (C2), the physiological substrate for the proenzyme Cls, first complement component. The complement system is a central component of host defense but can also contribute to the inflammation seen in pathological conditions. The C1s protease of the C1 complex initiates the host defense pathway. This peptide employs 2Abz/Dnp FRET pair for quantitation of complement enzyme activity.)

HY-P3519

ACV Tripeptide	Peptides	Others
ACV Tripeptide is a key biosynthetic precursor of penicillin and cephalosporins and is found in Penicillium chrysogenum and Acremonium chrysogenum. ACV Tripeptide is synthesized by a large non-ribosomal peptide synthase called ACV synthase, which is encoded by the 11 kb The pchAB gene encodes this enzyme .

HY-P3632

[DAla2, DArg6] Dynorphin A, (1-13) (porcine) DADAD	Opioid Receptor	Neurological Disease Metabolic Disease
[DAla2, DArg6] Dynorphin A, (1-13) (porcine) (DADAD) is an opioid peptide (dynorphinl-13, DYN) derivative found in porcine pituitary extracts. DYN is highly potent at the peripheral opioid receptors GPI and MVD, but is readily and rapidly degraded in vivo. [DAla2, DArg6] Dynorphin A, (1-13) (porcine) has some resistance to enzymatic cleavage and prevents peptide cleavage by enzymes .

HY-120833

Ac-Ile-Glu-Thr-Asp-pNA	Caspase	Others
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .

HY-P1402

[Glu27]-PKC (19-36)	Peptides	Others
[Glu27]-PKC (19-36) is an inactive control for protein kinase C (PKC) (19-36). PKC (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C, it may be responsible for maintaining the enzyme in the inactive form in the absence of allosteric activators such as phospholipids .

HY-P10172

Abz-SDK(Dnp)P-OH	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .

HY-W012159

Methionylserine H-MET-SER-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a K_m value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .

HY-P5510

Ac-Asp-Glu-Asp(EDANS)-Glu-Glu-Abu-ψ-(COO)Ala-Ser-Lys(DABCYL)-NH2 HCV NS3 protease substrate	Peptides	Others
Ac-Asp-Glu-Asp(EDANS)-Glu-Glu-Abu-ψ-(COO)Ala-Ser-Lys(DABCYL)-NH2 (HCV NS3 protease substrate) is a biological active peptide. (This peptide is a HCV protease substrate incorporating an ester bond between residues P1 and P1. Due to ready transesterification of the scissile bond to the acyl-enzyme intermediate, this substrate shows very high kcat/Km values, enabling detection of activity with subnanomolar nonstructural protein 3 (NS3 protease) concentrations. It is widely used for the continuous assay of NS3 protease activity. Substrate cleavage is proportional to the enzyme concentration with a detection limit for NS3 between 1 nM and 250 pM. Upon cleavage of this substrate, fluorescence can be monitored at Abs/Em = 355/500 nm.)

HY-P6020A

HBpep-SA TFA	Peptides	Others
HBpep-SA is a cell membrane-permeable peptide condensate that phase separates to form stable droplets at pH values below 6.5. HBpep-SA is able to directly and efficiently deliver a variety of macromolecules, ranging from therapeutic peptides as small as 726 Da to large enzymes as large as 430 kDa, and the loaded condensates remain stable under near-physiological and serum conditions until internalized by cells. HBpep-SA can be used for intracellular delivery of large numbers of macromolecules and as a vector for mRNA-based vaccines .

HY-P6020

HBpep-SA	Biochemical Assay Reagents	Others
HBpep-SA is a cell membrane-permeable peptide condensate that phase separates to form stable droplets at pH values below 6.5. HBpep-SA is able to directly and efficiently deliver a variety of macromolecules, ranging from therapeutic peptides as small as 726 Da to large enzymes as large as 430 kDa, and the loaded condensates remain stable under near-physiological and serum conditions until internalized by cells. HBpep-SA can be used for intracellular delivery of large numbers of macromolecules and as a vector for mRNA-based vaccines .

HY-P6020B

HBpep-SA acetate	Biochemical Assay Reagents	Others
HBpep-SA acetate is a cell membrane-permeable peptide condensate that phase separates to form stable droplets at pH values below 6.5. HBpep-SA acetate is able to directly and efficiently deliver a variety of macromolecules, ranging from therapeutic peptides as small as 726 Da to large enzymes as large as 430 kDa, and the loaded condensates remain stable under near-physiological and serum conditions until internalized by cells. HBpep-SA acetate can be used for intracellular delivery of large numbers of macromolecules and as a vector for mRNA-based vaccines .

HY-P5296

Dabsyl-Leu-Gly-Gly-Gly-Ala-Edans	Fluorescent Dye	Others
Dabsyl-Leu-Gly-Gly-Gly-Ala-Edans is a fluorophore Dabsyl-labeled peptide. Dabsyl-Leu-Gly-Gly-Gly-Ala-Edans can be used to test the peptidase activity of the LasA protease of Pseudomonas aeruginosa. Dabsyl-Leu-Gly-Gly-Gly-Ala-Edans has enzyme specificity and has application value .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P10602

PKA Regulatory Subunit II Substrate RII phosphopeptide	PKA	Others
PKA Regulatory Subunit II Substrate (RII phosphopeptide) is a tool peptide derived from the regulatory subunit Type II (RII) of cyclic AMP-dependent protein kinase (PKA). PKA Regulatory Subunit II Substrate is commonly used to mimic the phosphorylation of protein kinases and as a specific substrate for protein phosphatases to assess the activities of these enzymes .

HY-P10609

Btk substrate peptide	Btk	Others
Btk substrate peptide is a peptide substrate corresponding to residues 217-229 of human Bruton’s tyrosine kinase (Btk), of which the tyrosine at residue 223 is the major autophosphorylation site of Btk. Btk substrate peptide is used as a substrate in in vitro kinase assays to evaluate the activity of Btk or other tyrosine kinases .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an *angiotensin-converting Enzyme* (ACE)** inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

HY-P4899

RE(EDANS)EVNLDAEFK(DABCYL)R	Beta-secretase	Neurological Disease
RE (EDANS) EVNLDAEFK (DABCYL) R is an EDANS and DABCYL double-labeled peptide，serves as a fluorescent substrate for BACE1(Em=360nm，Ex=528nm). RE (EDANS) EVNLDAEFK (DABCYL) R can be used for BACE1 activity measurement and the enzyme activity level is directly proportional to the fluorescence reaction .

HY-P2651

Dansyl-D-Ala-Gly-Phe(pNO2)-Gly	Fluorescent Dye	Others
Dansyl-D-Ala-Gly-Phe(pNO2)-Gly is a synthetic peptide substrate. As a substrate of NEP, Dansyl-D-Ala-Gly-Phe(pNO2)-Gly can be specifically recognized and cleaved by the enzyme, thereby releasing the fluorophore dansyl, which can be quantitatively detected. Therefore, it is often used to determine the activity of NEP .

HY-P3722A

Mca-PLAQAV-Dpa-RSSSR-NH2 TFA	Fluorescent Dye MMP	Others
Mca-PLAQAV-Dpa-RSSSR-NH2 is a fluorescent peptide and as one of fluorescent substrates of TNF-α converting enzyme (TACE): ADAM17, ADAM 9 and ADAM 10. Mca-PLAQAV-Dpa-RSSSR-NH2 is a substrate based on fluorescence resonance energy transfer, and its activity can be determined by the change of fluorescence intensity during pyrolysis .

Cat. No.	Product Name		Classification

HY-145934

UDP-GalNAz disodium UDP-N-azidoacetylgalactosamine disodium		Azide
UDP-GalNAz disodium (UDP-N-azidoacetylgalactosamine disodium) is the analogue of UDP-GalNAc. UDP-GalNAc is the donor substrate of many N-acetylgalactosaminyltransferases, enzymes which transfer GalNAc from the nucleotide sugar to a saccharide or peptide acceptor . UDP-GalNAz (disodium) is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

Cat. No.	Product Name		Classification