Search Result

Results for "

Angiotensin peptide

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (25) Angiotensin-converting Enzyme (ACE) (21) Antibiotic (1) Apelin Receptor (APJ) (1) Apoptosis (4) Biochemical Assay Reagents (1) Endogenous Metabolite (4) Endothelin Receptor (2) Isotope-Labeled Compounds (1) Neprilysin (2) NF-κB (1) Opioid Receptor (1) Renin (1)
By Research Areas:	Cancer (4) Cardiovascular Disease (42) Endocrinology (14) Infection (2) Inflammation/Immunology (4) Metabolic Disease (9) Neurological Disease (3)

Inhibitors & Agonists

Peptides

Natural
Products

Isotope-Labeled Compounds

Targets Recommended: Angiotensin Receptor Natriuretic Peptide Receptor (NPR) Formyl Peptide Receptor (FPR) Angiotensin-converting Enzyme (ACE) CGRP Receptor Amyloid-β

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P2217

Aclerastide DSC-127; NorLeu3-A(1-7)	Angiotensin Receptor	Inflammation/Immunology
Aclerastide (DSC-127) is an angiotensin receptor agonist. Aclerastide also is a peptide analog of angiotensin II. Aclerastide can be used for the research of tissue regeneration in diabetic ulcers .

HY-P1486

Angiotensinogen (1-14), human	Endogenous Metabolite	Cardiovascular Disease
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the angiotensin converting enzyme 2 .

HY-P5939

Angiotensinogen (1-13) (human)	Angiotensin Receptor	Cardiovascular Disease
Angiotensinogen (1-13) (human) is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1486A

Angiotensinogen (1-14), human TFA	Endogenous Metabolite	Cardiovascular Disease
Angiotensinogen (1-14), human TFA is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .

HY-W140282

Angiotensin II antipeptide	Angiotensin Receptor	Cardiovascular Disease
Angiotensin II antipeptide, a peptide, is an inverse agonist of AR1 receptor. Angiotensin II antipeptide is encoded by mRNA, complementary to that encoding Angiotensin II (HY-13948) itself .

HY-P10182

Angiotensin III antipeptide	Antibiotic	Infection
Angiotensin III antipeptide is a peptide antibiotic .

HY-P1839

Angiotensin I/II (1-5)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-5 is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1839A

Angiotensin I/II (1-5) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-5 TFA is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P0080

Novokinin	Angiotensin Receptor	Metabolic Disease
Novokinin is a peptide agonist of the angiotensin AT2 receptor .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P0080A

Novokinin TFA	Angiotensin Receptor	Metabolic Disease
Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P1564

[Sar1, Ile8]-Angiotensin II	Angiotensin Receptor	Cardiovascular Disease Endocrinology
[Sar1, Ile8]-Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.

HY-P1564A

[Sar1, Ile8]-Angiotensin II TFA AngiotensinII TFA; Angiotensin 2 TFA	Angiotensin Receptor	Others
[Sar1, Ile8]-Angiotensin II (TFA) is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.

HY-P1769

Angiotensin II (5-8), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-E70421

Butelase 1 ligase	Others	Others
Butelase 1 ligase can be used for the cyclization of food-derived angiotensin I converting enzyme (ACE) inhibitory peptides, and thus improves the stability and bioactivity of ACE inhibitory peptides .

HY-13948BS

Angiotensin II human-13C6,15N TFA Angiotensin II-13C₆,¹⁵N TFA; Ang II-13C₆,¹⁵N TFA; DRVY(I-13C₆,¹⁵N)HPF TFA	Isotope-Labeled Compounds	Cancer
Angiotensin II human- ¹³C₆, ¹⁵N TFA (Ang II- ¹³C₆, ¹⁵N TFA) is ¹³C- and ¹⁵N-labeled Angiotensin II human (TFA) (HY-13948B). Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions .

HY-13948

Angiotensin II human Maximum Cited Publications 112 Publications Verification Angiotensin II; Ang II; DRVYIHPF	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-13948A

Angiotensin II human acetate Maximum Cited Publications 112 Publications Verification Angiotensin II acetate; Ang II acetate; DRVYIHPF acetate	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) acetate is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human acetate plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human acetate stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human acetate induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human acetate also induces apoptosis. Angiotensin II human acetate induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-13948B

Angiotensin II human TFA Maximum Cited Publications 112 Publications Verification Angiotensin II TFA; Ang II TFA; DRVYIHPF TFA	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human TFA induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human TFA also induces apoptosis. Angiotensin II human TFA induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-19214

Elisartan HN 65021	Angiotensin Receptor	Cardiovascular Disease Endocrinology
Elisartan is an orally active non-peptide pro-agent of angiotensin II AT1 receptor antagonist HN-12206, and shows anti-hypertension activities.

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific angiotensin-converting enzyme (ACE) inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-103247B

EMD-66684 potassium salt	Angiotensin Receptor	Cardiovascular Disease
EMD-66684 potassium salt is a non-peptide angiotensin II receptor antagonist that demonstrates significant antihypertensive effects in spontaneously hypertensive rats. EMD-66684 potassium salt exhibits nanomolar affinity for angiotensin II receptors, comparable to losartan in potency. EMD-66684 potassium salt shows increased activity when modified with acetamides, leading to superior blood pressure reduction.

HY-P2563

[Tyr(P)4] Angiotensin II	Angiotensin Receptor	Metabolic Disease
[Tyr(P)4] Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P3108

Alamandine	Angiotensin Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through anti-hypertensive actions .

HY-P1236

Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse Atrial natriuretic factor (1-28) (rat, mouse)	Endothelin Receptor	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.

HY-P1236A

Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse TFA Atrial natriuretic factor (1-28) (rat, mouse) TFA	Endothelin Receptor	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.

HY-P10173

Abz-LFK(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .

HY-18211

CGS 35601	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
CGS 35601 is the inhibitor for endothelin-converting enzyme-1 (ECE-1), neutral endopeptidase 24.11 (NEP), and angiotensin-converting enzyme (ACE), with IC₅₀s of 55, 2, and 22 nM, respectively. CGS 35601 suppresses the big endothelin-1 (big ET-1)- and angiotensin I-induced pressor response, and enhances circulation of atrial natriuretic peptide (ANP), regulates the cardiovascular function in SD rats .

HY-A0114

Moexiprilat RS 10029	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Moexiprilat is an inhibitor of angiotensin-converting enzyme (ACE; IC₅₀=2.1 nM) and an active metabolite of the prodrug Moexipril (HY-117281). It is formed from moexipril in vivo by side chain ester hydrolysis. Moexiprilat (10 nM) prevents the estrone- or angiotensin II-stimulated proliferation of primary neonatal rat cardiac fibroblasts. It reduces mean arterial blood pressure and increases the levels of atrial natriuretic peptide, a marker of hypertension, in ovariectomized mice when administered at a dose of 50 mg/kg per day.

HY-125976

ML233	Apelin Receptor (APJ)	Cardiovascular Disease
ML233 is a non-peptide based potent apelin receptor (APJ) agonist (EC₅₀=3.7 μM). ML233 displays >21-fold selective over the closely related angiotensin 1 (AT1) receptor (>79 μM) .

HY-125341

Microginin 527	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Microginin 527 is a linear cyanobacterial peptide with potent angiotensin-converting enzyme (ACE) inhibitory activity. Microginin 527 also exhibits inhibitory effects on protein phosphatases and leucine aminopeptidase. With an IC50 value of 31 μM, Microginin 527 is the most active component in this class of compounds .

HY-P10172

Abz-SDK(Dnp)P-OH	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .

HY-114782

H-Tyr-Tyr-OH L-Tyrosyl-L-tyrosine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Tyr-Tyr-OH (L-Tyrosyl-L-tyrosine) is an antihypertensive peptide. H-Tyr-Tyr-OH inhibits angiotensin I-converting enzyme (ACE) with an IC₅₀ value of 0.028 mg/mL. H-Tyr-Tyr-OH can be used for the research of high blood pressure .

HY-E70395

Prolyl endopeptidase PE; PEP	Biochemical Assay Reagents	Neurological Disease
Prolyl Endopeptidase, highly active in brain and other tissues, catabolizes proline-containing peptides such as substance P, neurotensin, luteinizing hormone-releasing hormone, thyrotropin releasing hormone, bradykinin and angiotensin II. Prolyl Endopeptidase can be used for study of neuropsychiatric diseases such as stress disorder, depression, and schizophrenia .

HY-112824

L-162313	Angiotensin Receptor	Cardiovascular Disease
L-162313 is a non-peptide angiotensin II AT1 and AT2 receptor agonist, with IC₅₀ values of 1.1 and 2.0 nM for AT1 and AT2 receptor, respectively. L-162313 can be used for the research of vasoconstriction, aldosterone release, and cardiovascular growth .

Cat. No.	Product Name	Target	Research Area

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P2217

Aclerastide DSC-127; NorLeu3-A(1-7)	Angiotensin Receptor	Inflammation/Immunology
Aclerastide (DSC-127) is an angiotensin receptor agonist. Aclerastide also is a peptide analog of angiotensin II. Aclerastide can be used for the research of tissue regeneration in diabetic ulcers .

HY-P1486

Angiotensinogen (1-14), human	Endogenous Metabolite	Cardiovascular Disease
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the angiotensin converting enzyme 2 .

HY-P5939

Angiotensinogen (1-13) (human)	Angiotensin Receptor	Cardiovascular Disease
Angiotensinogen (1-13) (human) is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1486A

Angiotensinogen (1-14), human TFA	Endogenous Metabolite	Cardiovascular Disease
Angiotensinogen (1-14), human TFA is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE) .

HY-110183

Angiotensin A	Peptides	Cardiovascular Disease
Angiotensin A is a renin–angiotensin system (RAS) peptide that causes a vasoconstrictive effect dependent on AT₁ receptors. Angiotensin A elicits pressor and renal vasoconstrictor responses in normotensive and hypertensive rats .

HY-W140282

Angiotensin II antipeptide	Angiotensin Receptor	Cardiovascular Disease
Angiotensin II antipeptide, a peptide, is an inverse agonist of AR1 receptor. Angiotensin II antipeptide is encoded by mRNA, complementary to that encoding Angiotensin II (HY-13948) itself .

HY-P10182

Angiotensin III antipeptide	Antibiotic	Infection
Angiotensin III antipeptide is a peptide antibiotic .

HY-P4891

Angiotensin (1-12) (human)	Peptides	Others
Angiotensin (1-12) (human) is an endogenous substrate for the production of biologically active **angiotensin peptides** by a non-renin-dependent mechanism .

HY-P3545

5-Valine-angiotensin I	Peptides	Cardiovascular Disease
5-Valine-angiotensin I is an Ang I peptide belonging to angiotensin I. 5-Valine-angiotensin I induces muscle contraction, can be used for renin-angiotensin system studies. Angiotensin I is a putative neurotransmitter, is the precursor of angiotensin II and of angiotensin fragment 1-7, which are involved in regulation of fluid volume and the release of aldosterone .

HY-P1839

Angiotensin I/II (1-5)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-5 is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1839A

Angiotensin I/II (1-5) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-5 TFA is a peptide that contains the amino acids 1-5, which is converted from Angiotensin I/II. Angiotensin I is formed by the action of renin on angiotensinogen. Angiotensin II is produced from angiotensin I. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P0080

Novokinin	Angiotensin Receptor	Metabolic Disease
Novokinin is a peptide agonist of the angiotensin AT2 receptor .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P0080A

Novokinin TFA	Angiotensin Receptor	Metabolic Disease
Novokinin TFA is a peptide agonist of the angiotensin AT2 receptor .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-129067

Brain natriuretic peptide BNP (1-32), human	Peptides	Cardiovascular Disease
Brain natriuretic peptide inhibits angiotensin II-induced blood pressure. Brain natriuretic peptide can be used in the control of blood pressure .

HY-13948F

Biotin-Ahx-Angiotensin II human Biotin-Ahx-Angiotensin II; Biotin-Ahx-Ang II; Biotin-Ahx-DRVYIHPF	Peptides	Others
Biotin-Ahx-Angiotensin II human (Biotin-Ahx-Angiotensin II; Biotin-Ahx-Ang II; Biotin-Ahx-DRVYIHPF) is a biological active peptide. (biotin labeled HY-13948)

HY-13948F1

Angiotensin II human, FAM-labeled Angiotensin II, FAM-labeled ; Ang II, FAM-labeled ; DRVYIHPF, FAM-labeled	Peptides	Others
Angiotensin II human, FAM-labeled (Angiotensin II, FAM-labeled ; Ang II, FAM-labeled ; DRVYIHPF, FAM-labeled) is a biological active peptide. (FAM labeled HY-13948)

HY-P1564

[Sar1, Ile8]-Angiotensin II	Angiotensin Receptor	Cardiovascular Disease Endocrinology
[Sar1, Ile8]-Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.

HY-P1564A

[Sar1, Ile8]-Angiotensin II TFA AngiotensinII TFA; Angiotensin 2 TFA	Angiotensin Receptor	Others
[Sar1, Ile8]-Angiotensin II (TFA) is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels.

HY-P1769

Angiotensin II (5-8), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (5-8), human is an endogenous C-terminal fragment of the peptide vasoconstrictor angiotensin II . Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P3910

[Val4] Angiotensin III	Peptides	Cardiovascular Disease
[Val4] Angiotensin III is an angiotension III peptide. [Val4] Angiotensin III is a potent full agonist of Gα_q and βarr2 response, with pEC₅₀ values of 8.31 and 8.44, respectively .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-13948

Angiotensin II human Maximum Cited Publications 112 Publications Verification Angiotensin II; Ang II; DRVYIHPF	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-13948A

Angiotensin II human acetate Maximum Cited Publications 112 Publications Verification Angiotensin II acetate; Ang II acetate; DRVYIHPF acetate	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) acetate is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human acetate plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human acetate stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human acetate induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human acetate also induces apoptosis. Angiotensin II human acetate induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-13948B

Angiotensin II human TFA Maximum Cited Publications 112 Publications Verification Angiotensin II TFA; Ang II TFA; DRVYIHPF TFA	Angiotensin Receptor Apoptosis	Cardiovascular Disease Endocrinology Cancer
Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human TFA induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human TFA also induces apoptosis. Angiotensin II human TFA induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific angiotensin-converting enzyme (ACE) inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P2563

[Tyr(P)4] Angiotensin II	Angiotensin Receptor	Metabolic Disease
[Tyr(P)4] Angiotensin II is a peptide that has multiple effects on vascular smooth muscle, including contraction of normal arteries and hypertrophy or hyperplasia of cultured cells or diseased vessels .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P10597

Angiotensin II type 1 receptor (181-187)	Peptides	Others
Angiotensin II type 1 receptor (181-187) is a 9-amino acid sequence of the second extracellular loop of angiotensin II (Ang II) in the renin-angiotensin system. Angiotensin II type 1 receptor (181-187) serves as the localization epitope of angiotensin II receptor autoantibodies (AT1RaAb) and is used to detect and quantify AT1RaAb levels in serum .

HY-P3108

Alamandine	Angiotensin Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Alamandine, a member of the renin-angiotensin system (RAS), a vasoactive peptide, is an endogenous ligand of the G protein-coupled receptor MrgD. Alamandine targets to protect the kidney and heart through anti-hypertensive actions .

HY-P1236

Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse Atrial natriuretic factor (1-28) (rat, mouse)	Endothelin Receptor	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.

HY-P1236A

Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse TFA Atrial natriuretic factor (1-28) (rat, mouse) TFA	Endothelin Receptor	Cardiovascular Disease Endocrinology
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.

HY-P10173

Abz-LFK(Dnp)-OH	Angiotensin-converting Enzyme (ACE)	Others
Abz-LFK(Dnp)-OH is an angiotensin I-converting enzyme (ACE) peptide substrate. Abz-LFK(Dnp)-OH is selective for the C domain of ACE. Abz-LFK(Dnp)-OH can be used to assess ACE activity .

HY-P10172

Abz-SDK(Dnp)P-OH	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Abz-SDK(Dnp)P-OH is a fluorescence peptide. Abz-SDK(Dnp)P-OH is the substrate of angiotensin I-converting enzyme (ACE). Abz-SDK(Dnp)P-OH has fluorescent donor-acceptor pair Abz and Dnp (2,4-dinitrophenyl) .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an angiotensin-converting Enzyme (ACE) inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-13948

Angiotensin II human 110+ Cited Publications Angiotensin II; Ang II; DRVYIHPF	Structural Classification Natural Products Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields Endocrinology Cancer	Angiotensin Receptor Apoptosis
Angiotensin II (Angiotensin II) is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions. Angiotensin II human induces growth of vascular smooth muscle cells, increases collagen type I and III synthesis in fibroblasts, leading to thickening of the vascular wall and myocardium, and fibrosis. Angiotensin II human also induces apoptosis. Angiotensin II induces capillary formation from endothelial cells via the LOX-1 dependent redox-sensitive pathway .

Cat. No.	Product Name	Chemical Structure

HY-13948BS

Angiotensin II human-13C6,15N TFA

Angiotensin II human- ¹³C₆, ¹⁵N TFA (Ang II- ¹³C₆, ¹⁵N TFA) is ¹³C- and ¹⁵N-labeled Angiotensin II human (TFA) (HY-13948B). Angiotensin II human (Angiotensin II) TFA is a vasoconstrictor and a major bioactive peptide of the renin/angiotensin system. Angiotensin II human TFA plays a central role in regulating human blood pressure, which is mainly mediated by interactions between Angiotensin II and the G-protein-coupled receptors (GPCRs) Angiotensin II type 1 receptor (AT1R) and Angiotensin II type 2 receptor (AT2R). Angiotensin II human TFA stimulates sympathetic nervous stimulation, increases aldosterone biosynthesis and renal actions .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

Angiotensin peptide

Inhibitors & Agonists

Peptides

NaturalProducts

Isotope-Labeled Compounds

Natural
Products