GHRF, porcine

Cat. No.: HY-P3595: FAQs
Data Sheet Handling Instructions

Molarity Calculator

GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone.

For research use only. We do not sell to patients.

GHRF, porcine Chemical Structure

CAS No. : 88384-73-0

Size		Stock
MOQ		Minimum order quantity
50 mg		Get quote
100 mg		Get quote
250 mg		Get quote
Other size		Get quote

Synthetic products have potential research and development risk.

* Please select Quantity before adding items.

This product is a controlled substance and not for sale in your territory.

Featured Recommendations

•Related Small Molecules:

•Related Proteins:

View All GHSR Isoform Specific Products:

View All Isoforms

GHSR1a

Biological Activity
Purity & Documentation
References
Customer Review

Description

GHRF, porcine is a growth hormone releasing factor (GHRF) peptide (porcine). GHRF binds to GHSR and induces the release of growth hormone^[1]^[2].

In Vitro

GHRF, porcine (50 pM) induces GH release in rat anterior pituitary cells^[1].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

In Vivo

GHRF, porcine (0.5 μg/kg, i.v.) increases plasma concentrations of porcine somatotropin (pST) in pigs^[2].

MedChemExpress (MCE) has not independently confirmed the accuracy of these methods. They are for reference only.

Animal Model:	Pigs^[2]
Dosage:	0.5 μg/kg
Administration:	Intravenous injection (i.v.)
Result:	Increased plasma concentrations of porcine somatotropin (pST) in control pigs, without any pST response in pST-treated pigs.

Molecular Weight

5108.76

Formula

C₂₁₉H₃₆₅N₇₃O₆₆S

CAS No.

88384-73-0

Sequence Shortening

YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2

Shipping

Room temperature in continental US; may vary elsewhere.

Storage

Please store the product under the recommended conditions in the Certificate of Analysis.

Purity & Documentation

Handling Instructions (2659 KB)

References

[1]. Vigh S, et al. Interaction between hypothalamic peptides in a superfused pituitary cell system. Peptides. 1984;5 Suppl 1:241-7. [Content Brief]

[2]. Klindt J, et al. Influence of porcine somatotropin administration and sex on glucose and endocrine responses in obese pigs. Proc Soc Exp Biol Med. 1994 Oct;207(1):48-56. [Content Brief]

GHRF, porcine Related Classifications

Endocrinology

Molarity Calculator
Dilution Calculator

The molarity calculator equation

Mass (g) = Concentration (mol/L) × Volume (L) × Molecular Weight (g/mol)

Mass		Concentration		Volume		Molecular Weight *
	=		×		×

The dilution calculator equation

Concentration _(start) × Volume _(start) = Concentration _(final) × Volume _(final)

This equation is commonly abbreviated as: C₁V₁ = C₂V₂

Concentration _(start)	×	Volume _(start)	=	Concentration _(final)	×	Volume _(final)
	×		=		×
C1		V1		C2		V2

Help & FAQs

Do most proteins show cross-species activity?
Species cross-reactivity must be investigated individually for each product. Many human cytokines will produce a nice response in mouse cell lines, and many mouse proteins will show activity on human cells. Other proteins may have a lower specific activity when used in the opposite species.

Keywords:

GHRF, porcine88384-73-0GHSRGrowth hormone secretagogue receptorGhrelin receptorGHRHGHRFgrowth hormoneporcine somatotropinGHInhibitorinhibitorinhibit

Your Recently Viewed Products:

Product Name

Salutation

Applicant Name *

Email Address *

Phone Number *

Organization Name *

Department *

Requested quantity *

Country or Region *

Remarks