Search Result

Results for "

peptide sequence

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Amyloid-β (4) 15-PGDH (1) ADC Linker (2) Akt (3) Amino Acid Derivatives (4) Amylin Receptor (1) Angiotensin-converting Enzyme (ACE) (1) Apoptosis (2) Arenavirus (4) Arf Family GTPase (1) Autophagy (1) Bacterial (4) Bcl-2 Family (1) Biochemical Assay Reagents (10) Bradykinin Receptor (1) Casein Kinase (1) Caspase (3) CD47 (2) CDK (3) Complement System (2) Dipeptidyl Peptidase (1) Dopamine Receptor (1) Drug Isomer (1) DYRK (1) EGFR (1) Endogenous Metabolite (2) Endonuclease (1) Endothelin Receptor (3) Epigenetic Reader Domain (1) Factor XI (1) Fluorescent Dye (2) Fungal (1) Gap Junction Protein (2) GLP Receptor (1) Glycosidase (1) GnRH Receptor (3) HIV (3) iGluR (2) Indoleamine 2,3-Dioxygenase (IDO) (1) Influenza Virus (1) Integrin (7) Interleukin Related (2) LIM Kinase (LIMK) (1) Liposome (9) Lipoxygenase (1) MARCKS (4) MDM-2/p53 (5) MHC (1) Microtubule/Tubulin (1) MMP (2) Mucin (1) Myosin (1) NADPH Oxidase (1) Neuropeptide FF Receptor (1) Neuropeptide Y Receptor (1) NO Synthase (2) Opioid Receptor (1) Parasite (1) PD-1/PD-L1 (2) PKC (6) Potassium Channel (1) Protease Activated Receptor (PAR) (6) Protein Arginine Deiminase (1) PSMA (1) Ras (1) Reverse Transcriptase (1) SARS-CoV (1) Secretin Receptor (1) STAT (2) Telomerase (1) TGF-β Receptor (3) Transmembrane Glycoprotein (3) TREM receptor (1) TRP Channel (2) VEGFR (2)
By Research Areas:	Cancer (55) Cardiovascular Disease (15) Endocrinology (9) Infection (15) Inflammation/Immunology (23) Metabolic Disease (2) Neurological Disease (27)
Click Chemistry:	Azide (2) Alkynes (1)
Oligonucleotides:	Pegylated Lipids (3)

149

Inhibitors & Agonists

Fluorescent Dye

Biochemical Assay Reagents

174

Peptides

Inhibitory Antibodies

Natural
Products

Click Chemistry

Oligonucleotides

Cys-Penetratin	Amino Acid Derivatives	Others
Cys-Penetratin is a cell-penetrating peptide (CPP) with sequence of CRQIKIWFQNRRMKWKK .

S12	Ras	Others
S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .

APTSTAT3-9R, scrambled APTscr-9R	STAT	Others
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .

Scrambled 10Panx FSVYWAQADR	Gap Junction Protein	Others
Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .

Terrelumamide A	Others	Endocrinology
Terrelumamide A is a lumazine-containing peptide. Terrelumamide A is isolated from the culture broth of the marine-derived fungus Aspergillus terreus. Terrelumamide A exhibits pharmacological activity by improving insulin sensitivity. Terrelumamide A has the potential in the application of DNA sequence recognition .

CKS-17	Reverse Transcriptase	Inflammation/Immunology
CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .

Influenza A NP (383-391) (HLA-B27)	Transmembrane Glycoprotein Influenza Virus	Cancer
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .

PAD4-IN-3	Protein Arginine Deiminase	Cancer
PAD4-IN-3 (compound 4B) is a PAD4 inhibitor with antitumor activity in vitro and in vivo. PAD4-IN-3 was covalently linked to RGD sequence peptide-modified chitosan (K-CRGDV), resulting in an enhanced oxidative stress-responsive nanoagent. K-CRGDV-PAD4-IN-3 can actively target tumors, inhibit PAD4 activity, block the formation of neutrophil extracellular traps (NETs), and improve the tumor immune microenvironment in response to the tumor microenvironment .

R5 peptide	Biochemical Assay Reagents	Others
R5 peptide is one of the repeating peptide sequences that form the protein diatom in Cylindrotheca fusiformis. R5 peptide can be used as a template for the synthesis of Pd (palladium) nanoparticles (NPs). R5 peptide forms complexes with metal ions through the amine groups in its sequence, and the self-assembled structure of the peptide provides a confined spatial environment for the reduction of metal ions and the nucleation of nanoparticles. R5 peptide can be used in the research of biomimetic nanomaterials .

sgp91 ds-tat Peptide 2, scrambled	NADPH Oxidase	Cardiovascular Disease Cancer
sgp91 ds-tat Peptide 2, scrambled is a scrambled sequence of NADPH oxidase inhibitor gp91 ds-tat peptide .

Peptide 74	MMP	Cancer
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .

YQEAFRRFFGPV	Biochemical Assay Reagents	Others
YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability

H-L-Cys(MDNPE)-OH hydrochloride	Amino Acid Derivatives	Others
H-L-Cys(MDNPE)-OH hydrochloride is a cysteine derivative with a short peptide sequence attached to the thiol group of cysteine.

PKCδ Peptide Substrate	PKC	Others
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .

DB02307	Others	Others
DB02307 is a dipeptide that contains a sequence of two alpha-amino acids joined by a peptide bond .

β-Amyloid (31-35)	Amyloid-β	Neurological Disease
β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.

PMAP-36 Porcine cathelicidin PMAP-36	Bacterial	Infection
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .

RLLFT-NH2	Drug Isomer	Others
RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .

Crosstide 2 Publications Verification	Akt	Others
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.

Ac-MBP (1-11)	PKC	Neurological Disease
Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .

tLyP-1 peptide	Complement System	Cancer
tLyP-1 peptide is an NRP-1 targeting peptide with an IC₅₀ of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .

Gly-Phe-AMC	Biochemical Assay Reagents	Others
Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .

me4 Peptide	Amino Acid Derivatives	Neurological Disease
me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .

CREKA peptide	Biochemical Assay Reagents	Cardiovascular Disease Cancer
CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .

p53 CBS p53 Consensus binding sequence	MDM-2/p53	Others
p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)

CEDAEVFKDSMVPGEK	TRP Channel	Others
CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1 .

Nangibotide scrambled peptide 1 Publications Verification LR12-scr	TREM receptor	Inflammation/Immunology
Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .

CCK1-specific peptide substrate	Casein Kinase	Others
CCK1-specific peptide substrate is a biological active peptide. (This peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated. It is a peptide substrate for Casein Kinase I (CK1). CK1 phosphorylates Ser10. Ser7 is phosphorylated by PKA in vivo.)

Peptide 234CM	MDM-2/p53	Cancer
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .

H-Cys-Val-2-Nal-Met-OH	Others	Others
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences .

Ac-LDESD-AMC	Caspase	Cancer
Ac-LDESD-AMC is a caspase-2 inhibitor. Ac-LDESD-AMC has a peptide sequence of Leu-Asp-Glu-Ser-Asp .

KGDS	Integrin	Others
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser .

Ac-LEVD-CHO	Caspase	Cancer
Ac-LEVD-CHO is a caspase-4 inhibitor. Ac-LEVD-CHO is a peptide with the sequence of Ac-Leu-Glu-Val-Asp-al .

WYRGRL	MMP	Inflammation/Immunology
WYRGRL, a collagen II-targeting peptide, can bind to collagen II α1. WYRGRL is a short cartilage-targeting peptide sequence. WYRGRL leads to about 72-fold increase of cartilage-targeting efficiency for the peptide-functionalized nanoplatform in vivo .

β-Amyloid peptide(16-20) KLVFF	Amyloid-β	Neurological Disease
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH₂ residues added at N- and C-terminal ends to aid solubility) .

RLLFT-NH2 TFA	Protease Activated Receptor (PAR)	Others
RLLFT-NH2 TFA is a reversed amino acid sequence negative control peptide for TFLLR-NH2 (HY-P0226) .

RGD-4C	Integrin	Cancer
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .

Peptide C105Y TFA	Secretin Receptor	Cancer
Peptide C105Y TFA, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .

Kemptamide	Myosin	Cancer
Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .

Histone H1-derived Peptide	CDK	Others
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .

KGFRWR	Biochemical Assay Reagents	Cancer
KGFRWR is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. KGFRWR can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .

DYRKtide	DYRK	Others
DYRKtide is a biological active peptide. (Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.)

ARF6 (2-13)	Arf Family GTPase	Inflammation/Immunology
ARF6 (2-13) is a peptide with a sequence of GKVLSKIFGNKE. ARF6 (2-13) is an inhibitor of ARF6. ARF6 (2-13) can be used in the research of endotoxemia .

Fmoc-Pen(Acm)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .

Multi-Leu peptide ML-peptide, Multi-Leucine (ML)-peptide	Autophagy	Cancer
Multi-Leu peptide (ML-peptide) is a potent inhibitor of PACE4 (K_i=22 nM). Multi-Leu peptide can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide can be used to study the specific mechanism of PACE4 in the development of prostate cancer .

Thrombospondin-1 (1016-1023) (human, bovine, mouse)	CD47 Apoptosis	Inflammation/Immunology
Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .

Cat. No.	Product Name	Type

HY-137858

H-Gly-Arg-pNA hydrochloride Gly-Arg-4-NA hydrochloride; GR-pNA hydrochloride; GR p-itoailide hydrochloride	Dyes
H-Gly-Arg-pNA hydrochloride (GR-pNA hydrochloride) is a colorimetric substrate for thrombin. H-Gly-Arg-pNA is preferentially bound by thrombin and cleaves the Gly-Arg (GR) peptide sequence, releasing p-nitroaniline (pNA) that can be detected colorimetrically at 405 nm. H-Gly-Arg-pNA hydrochloride is used as a fluorescent dye to measure thrombin activity .

HY-D2439

RGD-PEG-Cy3

Fluorescent Dyes/Probes

RGD-PEG-Cy3 is a fluorescent labeling reagent that combines Cy3 fluorescent dye, peptide (RGD) and polyethylene glycol (PEG). The Cy3 fluorophore is commonly used in applications such as immunolabeling, nucleic acid labeling, fluorescence microscopy, and flow cytometry. Cy3 has an emission maximum around 562-570 nm. RGD is a peptide sequence (CRGDKGPDCiRGD) that binds to αvβ3 and αvβ5 integrin receptors on tumor neovasculogenesis to achieve specific tumor tissue targeting .

Cat. No.	Product Name	Type

HY-172714A

DSPE-PEG3400-MPG	Drug Delivery
DSPE-PEG3400-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .

HY-172714

DSPE-PEG2000-MPG	Drug Delivery
DSPE-PEG2000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .

HY-172713

DSPE-PEG1000-MPG	Drug Delivery
DSPE-PEG1000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .

HY-172715

DSPE-PEG5000-MPG	Drug Delivery
DSPE-PEG5000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .

HY-172283A

DSPE-PEG2000-BR2	Drug Delivery
DSPE-PEG2000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .

HY-172283C

DSPE-PEG3400-BR2	Drug Delivery
DSPE-PEG3400-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .

HY-172283

DSPE-PEG1000-BR2	Drug Delivery
DSPE-PEG1000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .

HY-172283B

DSPE-PEG5000-BR2	Drug Delivery
DSPE-PEG5000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .

Cat. No.	Product Name	Target	Research Area

HY-P3460A

TDSRCVIGLYHPPLQVY TFA	Peptides	Cardiovascular Disease Neurological Disease Inflammation/Immunology
TDSRCVIGLYHPPLQVY TFA is a disordered control peptide. TDSRCVIGLYHPPLQVY TFA is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .

HY-P5217

CSTSMLKAC (disulfide)	Peptides	Others
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .

HY-P3287

UL75 (14-42)，Human herpesvirus 5	Peptides	Others
UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .

HY-P3460

TDSRCVIGLYHPPLQVY	Peptides	Cardiovascular Disease Neurological Disease Inflammation/Immunology
TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .

HY-P10116

APTSTAT3-9R, scrambled APTscr-9R	STAT	Others
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .

HY-P1138

Scrambled 10Panx FSVYWAQADR	Gap Junction Protein	Others
Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .

HY-P2665

Lymphocyte activating pentapeptide	Peptides	Others
Lymphocyte activating pentapeptide is a short peptide sequence found in the Fc region of human IgG1 that has the ability to activate lymphocytes. Lymphocyte activating pentapeptide can be used to study the activation mechanisms of B cells and T cells, and their role in immune responses .

HY-P3051

CKS-17	Reverse Transcriptase	Inflammation/Immunology
CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .

HY-P10593

Influenza A NP (383-391) (HLA-B27)	Transmembrane Glycoprotein Influenza Virus	Cancer
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .

HY-P3956

Prosomatostatin (1-32), porcine	Peptides	Others
Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide .

HY-P5394

Dby HY Peptide (608-622), mouse	Peptides	Others
Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)

HY-P0329

X-press Tag Peptide	Peptides	Others
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.

HY-P4132

Membrane-Permeable Sequence, MPS	Peptides	Cancer
Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .

HY-P1965

Ac-IEVDIDV TFA	Peptides	Cancer
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.

HY-P1963

Ac-IEVDIDVEH TFA	Peptides	Cancer
Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.

HY-P1964

Ac-IEVDIDVE TFA	Peptides	Cancer
Ac-IEVDIDVE TFA is a short peptide sequence with Ac at the end.

HY-P1966

Ac-IEVDID TFA	Peptides	Cancer
Ac-IEVDID TFA is a short peptide sequence with Ac at the end.

HY-P1967

Ac-VDID TFA	Peptides	Cancer
Ac-VDID TFA is a short peptide sequence with Ac at the end.

HY-P4093

Cys-Penetratin	Amino Acid Derivatives	Others
Cys-Penetratin is a cell-penetrating peptide (CPP) with sequence of CRQIKIWFQNRRMKWKK .

HY-P10190

CADY	Peptides	Others
CADY is a *cell-penetrating peptide* (CPPs)** peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .

HY-P10156

MAP17 Cell-penetrating peptide MAP17	Peptides	Others
MAP17 (Cell-penetrating peptide MAP17) is a synthetic secondary amphipathic cell-penetrating peptides, with sequence of QLALQLALQALQAALQLA .

HY-P2361

S12	Ras	Others
S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .

HY-P10510

R5 peptide	Biochemical Assay Reagents	Others
R5 peptide is one of the repeating peptide sequences that form the protein diatom in Cylindrotheca fusiformis. R5 peptide can be used as a template for the synthesis of Pd (palladium) nanoparticles (NPs). R5 peptide forms complexes with metal ions through the amine groups in its sequence, and the self-assembled structure of the peptide provides a confined spatial environment for the reduction of metal ions and the nucleation of nanoparticles. R5 peptide can be used in the research of biomimetic nanomaterials .

HY-P2193

TAT-amide	Peptides	Infection
TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .

HY-P1908

sgp91 ds-tat Peptide 2, scrambled	NADPH Oxidase	Cardiovascular Disease Cancer
sgp91 ds-tat Peptide 2, scrambled is a scrambled sequence of NADPH oxidase inhibitor gp91 ds-tat peptide .

HY-P2641

Peptide 74	MMP	Cancer
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .

HY-P3526

YQEAFRRFFGPV	Biochemical Assay Reagents	Others
YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability

HY-P5119

Tat-peptide control 168-189	Peptides	Neurological Disease
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .

HY-P5119A

Tat-peptide control 168-189 TFA	Peptides	Neurological Disease
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .

HY-P2193A

TAT-amide TFA	Peptides	Infection
TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .

HY-P3818

PKCδ Peptide Substrate	PKC	Others
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .

HY-P1870

OVA sequence (323-336)	Peptides	Inflammation/Immunology
OVA sequence (323-336) is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogenicity.

HY-P1517

β-Amyloid (31-35)	Amyloid-β	Neurological Disease
β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.

HY-P4872

Alarin (human)	Peptides	Neurological Disease
Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP .

HY-P5118

Tat-peptide 190-208	Peptides	Neurological Disease
Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .

HY-P10187

α-Casein (90-96)	Peptides	Others
α-Casein (90-96) is a peptide with sequence of Arg-Tyr-Leu-Gly-Tyr-Leu-Glu .

HY-P10158

PMAP-36 Porcine cathelicidin PMAP-36	Bacterial	Infection
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .

HY-P1311

RLLFT-NH2	Drug Isomer	Others
RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .

HY-P0315

Crosstide 2 Publications Verification	Akt	Others
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.

HY-P1734

Ac-MBP (1-11)	PKC	Neurological Disease
Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .

HY-P10787

tLyP-1 peptide	Complement System	Cancer
tLyP-1 peptide is an NRP-1 targeting peptide with an IC₅₀ of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .

HY-P5353

PA22-2 IKVAV sequence; Laminin A-chain fragment	Peptides	Others
PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)

HY-P4054

IEIK 13	Peptides	Others
IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering

HY-P10020

Alrefimotide hTERT (660–689)	Peptides	Cancer
Alrefimotide is a hTERT-derived immunogenic peptide. Alrefimotide has a sequence of ALFSVLNYERARRPGLLGASVLGLDDIHRA. Alrefimotide can be used in cancer immunotherapy research .

HY-P4425

Gly-Phe-AMC	Biochemical Assay Reagents	Others
Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .

HY-P5118A

Tat-peptide 190-208 TFA	Peptides	Neurological Disease
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .

HY-P10778

me4 Peptide	Amino Acid Derivatives	Neurological Disease
me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .

HY-P10709

CREKA peptide	Biochemical Assay Reagents	Cardiovascular Disease Cancer
CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .

HY-P5343

p53 CBS p53 Consensus binding sequence	MDM-2/p53	Others
p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)

HY-P3702

CEDAEVFKDSMVPGEK	TRP Channel	Others
CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1 .

Cat. No.	Product Name	Target	Research Area

HY-P99591

Sontuzumab AS1402; huHMFG-1	Mucin	Cancer
Sontuzumab (AS1402) is a humanizedised IgG1κ MUC1 specific monoclonal antibody. Sontuzumab binds the extracellular MUC1 peptide sequence PDTR with a K_d of ~1 nM. Sontuzumab can be used for the research of breast cancer .

HY-P991158

Rinvatercept	TGF-β Receptor	Neurological Disease
Rinvatercept, a fusion protein, is a glycyl (1)-chimeric N-terminal (1-108)-peptide (2-109) combined from the sequences of the extracellular domains of the human ACVR2A/B, and is fused via a G3 peptide linker (110-112) to an immunoglobulin G1 (IgG1) Fc fragment. Rinvatercept can be used for research of neuromuscular disease .

HY-P990088

Sotiburafusp alfa	VEGFR PD-1/PD-L1	Cardiovascular Disease
Sotiburafusp alfa is a bispecific fusion protein, which is a humanized VEGFR-1 extracellular domain fragment (129-228, 1-100 in the current sequence) fused via the peptide linker ¹⁰¹GGSGGSGGSGGSGGS ¹¹⁵ to the N-terminus of the heavy chain (116-564) of a humanized IgG1-kappa anti-human PD-L1 heavy chain variant L352>A, L353>A. Sotiburafusp alfa is also an angiogenesis inhibitor .

Cat. No.	Product Name		Classification

HY-112295

AzKTB		Azide
AzKTB is a capture reagent which bears a short trypsin-cleavable peptide sequence between the azide module and the TAMRA/PEG-biotin labels. AzKTB is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.

HY-151678

N3-L-Lys(Mtt)-OH		Azide
N3-L-Lys(Mtt)-OH is a click chemistry reagent containing an azide group. N3-L-Lys(Mtt)-OH can introduce azide functions into the amino acid building block of peptide sequences at the N-terminal position. It contains an azide group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing alkyne groups. It can also undergo ring strain-promoted alkyne-azide cycloaddition (SPAAC) with molecules containing DBCO or BCN groups.

HY-151780

Fmoc-L-Dap(Pentynoyl)-OH		Alkynes
Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent containing an azide group. Fmoc-L-Dap(Pentynoyl)-OH serves as an amino acid building block for introducing alkyne functions into peptide sequences by standard Fmoc/tBu protocols. The alkyne residue can be engaged for copper catalyzed click reaction with organic azides or with tetrazines for copper-free conjugations . Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

Cat. No.	Product Name		Classification