Search Result
Results for "
peptide sequence
" in MedChemExpress (MCE) Product Catalog:
9
Biochemical Assay Reagents
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-P3051
-
|
|
Reverse Transcriptase
|
Inflammation/Immunology
|
|
CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
|
-
-
- HY-P4093
-
-
-
- HY-P2361
-
|
|
Ras
|
Others
|
|
S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .
|
-
-
- HY-P10116
-
|
APTscr-9R
|
STAT
|
Others
|
|
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
|
-
-
- HY-P1138
-
|
FSVYWAQADR
|
Gap Junction Protein
|
Others
|
|
Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
|
-
-
- HY-N6181
-
|
|
Others
|
Endocrinology
|
|
Terrelumamide A is a lumazine-containing peptide. Terrelumamide A is isolated from the culture broth of the marine-derived fungus Aspergillus terreus. Terrelumamide A exhibits pharmacological activity by improving insulin sensitivity. Terrelumamide A has the potential in the application of DNA sequence recognition .
|
-
-
- HY-P10593
-
|
|
Transmembrane Glycoprotein
Influenza Virus
|
Cancer
|
|
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
|
-
-
- HY-P11088
-
-
-
- HY-157157
-
|
|
Protein Arginine Deiminase
|
Cancer
|
|
PAD4-IN-3 (compound 4B) is a PAD4 inhibitor with antitumor activity in vitro and in vivo. PAD4-IN-3 was covalently linked to RGD sequence peptide-modified chitosan (K-CRGDV), resulting in an enhanced oxidative stress-responsive nanoagent. K-CRGDV-PAD4-IN-3 can actively target tumors, inhibit PAD4 activity, block the formation of neutrophil extracellular traps (NETs), and improve the tumor immune microenvironment in response to the tumor microenvironment .
|
-
-
- HY-P1908
-
-
-
- HY-P2641
-
|
|
MMP
|
Cancer
|
|
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
|
-
-
- HY-P3526
-
-
-
- HY-P3818
-
|
|
PKC
|
Others
|
|
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
|
-
-
- HY-W736950A
-
|
|
Amino Acid Derivatives
|
Others
|
|
H-L-Cys(MDNPE)-OH hydrochloride is a cysteine derivative with a short peptide sequence attached to the thiol group of cysteine.
|
-
-
- HY-148217
-
|
|
Others
|
Others
|
|
DB02307 is a dipeptide that contains a sequence of two alpha-amino acids joined by a peptide bond .
|
-
-
- HY-P1517
-
-
-
- HY-P10158
-
|
Porcine cathelicidin PMAP-36
|
Bacterial
|
Infection
|
|
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
|
-
-
- HY-P1311
-
|
|
Drug Isomer
|
Others
|
|
RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
|
-
-
- HY-P0315
-
|
|
Akt
|
Others
|
|
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
|
-
-
- HY-P1734
-
|
|
PKC
|
Neurological Disease
|
|
Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .
|
-
-
- HY-P10787
-
|
|
Complement System
|
Cancer
|
|
tLyP-1 peptide is an NRP-1 targeting peptide with an IC50 of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .
|
-
-
- HY-P10651
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
|
-
-
- HY-P4425
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .
|
-
-
- HY-P10778
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .
|
-
-
- HY-P10709
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Cancer
|
|
CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
-
-
- HY-P10709A
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Cancer
|
|
CREKA peptide acetate is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide acetate can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
-
-
- HY-P5343
-
|
p53 Consensus binding sequence
|
MDM-2/p53
|
Others
|
|
p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)
|
-
-
- HY-P10471E
-
|
MARCKS-ED control peptide TFA
|
MARCKS
|
Others
|
|
MPSD control peptide (MARCKS-ED control peptide) TFA is the control peptide of MPSD (HY-P10471). MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS) .
|
-
-
- HY-P1364
-
|
|
iGluR
|
Neurological Disease
|
|
Pep1-AGL is a peptide with the sequence of SSGMPLGAAGL. Pep1-AGL serves as the control peptide for Pep1-TGL (HY-P1367) .
|
-
-
- HY-P3702
-
|
|
TRP Channel
|
Others
|
|
CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1 .
|
-
-
- HY-P3211B
-
|
LR12-scr
|
TREM receptor
|
Inflammation/Immunology
|
|
Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .
|
-
-
- HY-P5526
-
|
|
Casein Kinase
|
Others
|
|
CCK1-specific peptide substrate is a biological active peptide. (This peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated. It is a peptide substrate for Casein Kinase I (CK1). CK1 phosphorylates Ser10. Ser7 is phosphorylated by PKA in vivo.)
|
-
-
- HY-P10610
-
|
|
MDM-2/p53
|
Cancer
|
|
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
|
-
-
- HY-151496
-
|
|
Others
|
Others
|
|
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences .
|
-
-
- HY-P10739
-
|
|
MMP
|
Inflammation/Immunology
|
|
WYRGRL, a collagen II-targeting peptide, can bind to collagen II α1. WYRGRL is a short cartilage-targeting peptide sequence. WYRGRL leads to about 72-fold increase of cartilage-targeting efficiency for the peptide-functionalized nanoplatform in vivo .
|
-
-
- HY-P10147
-
|
|
Caspase
|
Cancer
|
|
Ac-LDESD-AMC is a caspase-2 inhibitor. Ac-LDESD-AMC has a peptide sequence of Leu-Asp-Glu-Ser-Asp .
|
-
-
- HY-P3523
-
|
|
Integrin
|
Others
|
|
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser .
|
-
-
- HY-136727
-
|
|
Caspase
|
Cancer
|
|
Ac-LEVD-CHO is a caspase-4 inhibitor. Ac-LEVD-CHO is a peptide with the sequence of Ac-Leu-Glu-Val-Asp-al .
|
-
-
- HY-P5124
-
|
KLVFF
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
|
-
-
- HY-P1311A
-
-
-
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
-
-
- HY-P1781A
-
|
|
Secretin Receptor
|
Cancer
|
|
Peptide C105Y TFA, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .
|
-
-
- HY-P2162
-
|
|
Myosin
|
Cancer
|
|
Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .
|
-
-
- HY-P2480
-
|
|
CDK
|
Others
|
|
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .
|
-
-
- HY-P10705
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
KGFRWR is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. KGFRWR can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
-
-
- HY-P5430
-
|
|
DYRK
|
Others
|
|
DYRKtide is a biological active peptide. (Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.)
|
-
-
- HY-P10179
-
-
-
- HY-W101305
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .
|
-
-
- HY-P10422
-
|
ML-peptide, Multi-Leucine (ML)-peptide
|
Autophagy
|
Cancer
|
|
Multi-Leu peptide (ML-peptide) is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
|
-
-
- HY-P0144
-
|
|
CD47
Apoptosis
|
Inflammation/Immunology
|
|
Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .
|
-
- HY-P5444
-
|
|
Bacterial
|
Others
|
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
-
- HY-P3606
-
|
GAP (1-24), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (1-24), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 1-24 fragment (hGAP-1-24). GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
-
- HY-P1507
-
|
|
Integrin
|
Cardiovascular Disease
|
|
Fibrinogen Binding Inhibitor Peptide is a dodecapeptide (HHLGGAKQAGDV, H12), which is a fibrinogen γ-chain carboxy-terminal sequence (γ400-411). Fibrinogen Binding Inhibitor Peptide is a specific binding site of the ligand for activated glycoprotein (GP) IIb/IIIa.
|
-
- HY-P5483
-
|
|
Bacterial
|
Others
|
|
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)
|
-
- HY-P10471D
-
|
MARCKS-ED control peptide
|
MARCKS
PKC
|
Others
|
|
MPSD control peptide (MARCKS-ED control peptide) is a control peptide for MPSD peptide (HY-P10471). MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
-
- HY-P10422A
-
|
ML-peptide, Multi-Leucine (ML)-peptide triacetate
|
Autophagy
|
Cancer
|
|
Multi-Leu peptide (ML-peptide) triacetate is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide triacetate can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide triacetate can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
|
-
- HY-P1566
-
|
|
HIV
|
Infection
|
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
-
- HY-P0202
-
-
- HY-P10788
-
|
|
Complement System
|
Cancer
|
|
CK3 peptide is an NRP-1 targeting peptide with the amino acid sequence CLKADKAKC. The CK3 peptide specifically binds to NRP-1 to target breast cancer cells. Single-photon emission computed tomography (SPECT) and near-infrared fluorescence (NIRF) imaging show significant accumulation of CK3 peptide in xenograft tumors in nude mice. CK3 peptide can be used for molecular imaging studies of breast cancer.
|
-
- HY-P11000
-
|
|
Biochemical Assay Reagents
|
Others
|
|
INF7TAT is an amphipathic peptide containing the influenza HA2 sequence and the TAT peptide (HY-P0281). INF7TAT can associate with other macromolecules through non-covalent associations. INF7TAT can be used for non-toxic delivery of siRNAs .
|
-
- HY-150242A
-
|
|
Liposome
|
Others
|
|
Cbz-Ala-Ala-Asn TFA is a peptide that designed based on the sequence of the substrate of legumain. Legumain is a cysteine protease. Cbz-Ala-Ala-Asn TFA can be applied as a scaffold for drug delivery .
|
-
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-105067A
-
|
GV-1001 hydrochloride
|
Telomerase
|
Neurological Disease
|
|
Tertomotide (GV1001) hydrochloride is peptide vaccine consists a 16-aa human telomerase reverse transcriptase (hTERT) sequence. Tertomotide hydrochloride shows neuroprotective. Tertomotide hydrochloride has the potential for the research of Alzheimer's disease .
|
-
- HY-P0139
-
|
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment .
|
-
- HY-P2365
-
|
|
Fungal
|
Infection
|
|
Histatin-8 is a part of the Histatin-3 central sequence and is known as hemagglutination-inhibiting peptide. Histatin-8 is a potent anti-fungal peptide. Histatin-8 shows antimicrobial activity against yeast strains. Histatin-8 can be used for oral thrush research .
|
-
- HY-E70564
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Endoproteinase Arg-C is a serine endoproteinase that hydrolyzes peptide bonds on the carboxyl side of arginyl residues and has esterase and amidase activities. Endoproteinase Arg-C can be isolated from Clostridium histolyticum. Endoproteinase Arg-C is of mass spectrometry grade and can be used for peptide mapping, sequence analysis, cell separation .
|
-
- HY-P991158
-
|
|
TGF-β Receptor
|
Neurological Disease
|
|
Rinvatercept, a fusion protein, is a glycyl (1)-chimeric N-terminal (1-108)-peptide (2-109) combined from the sequences of the extracellular domains of the human ACVR2A/B, and is fused via a G3 peptide linker (110-112) to an immunoglobulin G1 (IgG1) Fc fragment. Rinvatercept can be used for research of neuromuscular disease .
|
-
- HY-P99591
-
|
AS1402; huHMFG-1
|
Mucin
|
Cancer
|
|
Sontuzumab (AS1402) is a humanizedised IgG1κ MUC1 specific monoclonal antibody. Sontuzumab binds the extracellular MUC1 peptide sequence PDTR with a Kd of ~1 nM. Sontuzumab can be used for the research of breast cancer .
|
-
- HY-P2039
-
-
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
-
- HY-P11094
-
|
|
TET Protein
|
Neurological Disease
|
|
Tet1 is a peptide with the sequence of HLNILSTLWKYRC. Tet1 can specifically bind to the neuronal ganglioside receptor GT1b and possesses neuronal targeting ability. Tet1 can be used in research related to drug delivery .
|
-
- HY-P1312
-
-
- HY-P4149
-
-
- HY-P5344
-
|
Fluorigenic PEXEL peptide
|
Parasite
|
Others
|
|
Dabcyl-LNKRLLHETQ-Edans (Fluorigenic PEXEL peptide) is a biological active peptide. (This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.)
|
-
- HY-P10457
-
|
15-PGDH (92-105)
|
15-PGDH
|
Others
|
|
5-Hydroxy prostaglandin dehydrogenase blocking peptide (15-PGDH (92-105)) is a blocking peptide that corresponds to the amino acids (AGVNNEKNWEKTLQ) located at positions 92-105 of the 15-hydroxy prostaglandin dehydrogenase (15-PGDH) sequence. 5-Hydroxy prostaglandin dehydrogenase blocking peptide can block the formation of protein-antibody complexes during immunohistochemical analysis of 15-PGDH .
|
-
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
-
- HY-P5499
-
|
|
MHC
|
Others
|
|
CMV pp65(13-27) is a biological active peptide. (This peptide is derived from amino acid residues 13 to 27 of the 65k lower matrix phosphoprotein of the human cytomegalovirus. It contains a nine-amino-acid sequence (LGPISGHVL) that matches the consensus binding motif for a major histocompatibility complex H2-Dd T-cell epitope.)
|
-
- HY-P3873
-
-
- HY-P1312A
-
-
- HY-P5370
-
|
|
Amyloid-β
|
Others
|
|
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
|
-
- HY-P1310
-
-
- HY-P1569
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-P10458
-
|
Human/rat 5-LO (130-149)
|
Lipoxygenase
|
Others
|
|
5-Lipoxygenase blocking peptide (Human/rat 5-LO 130-149) is a specific sequence fragment of 5-lipoxygenase (5-LOX), which can be utilized to prepare an antibody against 5-LOX .
|
-
- HY-P11349
-
|
|
Biochemical Assay Reagents
|
Others
|
|
TG-Gln (a glutamine donor peptide with the sequence H-NQEQVSPLERCG-NH₂) is a substrate-type crosslinker targeting activated coagulation transglutaminase XIII (FXIIIa). TG-Gln is promising for research of angiogenesis induction, cartilage repair, and wound healing .
|
-
- HY-P10176
-
|
|
Opioid Receptor
|
Others
|
|
Acetalin-2 is an opioid peptide with a sequence of Ac-Arg-Phe-Met-Trp-Met-Arg-NH2. Acetalin-2 is selectively bound to [ 3H]DAMGO with a K i value of 93.3 nM .
|
-
- HY-P2380
-
|
TFRGAP
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
PAR3 (1-6) is a synthetic peptide agonist of proteinase-activated receptor 1 (PAR1) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of human PAR3 and residues 39-44 of the full-length human sequence. PAR3 (1-6) activates p42/44 MAPK signaling in fibroblasts expressing PAR1, but not PAR3, an effect that can be blocked by the PAR1 antagonist RWJ 56110.
|
-
- HY-P1230
-
|
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity .
|
-
- HY-P10894
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
mUNO is a tumor-homing peptide (mUNO, sequence: "CSPGAK") that specifically binds to mouse CD206, targeting tumor-associated macrophages that express CD206/MRC1. mUNO can interact with human recombinant CD206 .
|
-
- HY-P1569A
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-172714A
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG3400-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172714
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG2000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172713
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG1000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172715
-
|
|
Liposome
|
Infection
|
|
DSPE-PEG5000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-P3509A
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-28 acetate is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 acetate can be used for pancreatic cancer research .
|
-
- HY-P10101
-
|
APTscr
|
STAT
|
Others
|
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
-
- HY-P3509
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-28 is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 can be used for pancreatic cancer research .
|
-
- HY-P1310A
-
-
- HY-P1371
-
|
KKWKMRRNQFWIKIQRC CSVEIWD*
|
PKC
|
Others
|
|
Pseudo RACK1, a peptide, is a PKC agonist with homologous sequences of PKC. Pseudo RACK1 interacts selectively with β-PKC at an autoregulatory site (RACK-binding site) and activates it in the absence of PKC activators, following inducing PKC-mediated histone phosphorylation .
|
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P10544
-
|
|
Interleukin Related
|
Others
|
|
Humanized anti-tac (HAT) binding peptide is a peptide that can specifically bind to the Fc region of HAT. HAT is a humanized monoclonal antibody against the low affinity p55 subunit of the interleukin IL-2 receptor. Humanized anti-tac (HAT) binding peptide can be used to develop affinity chromatography media to purify specific monoclonal antibodies .
|
-
- HY-NP202
-
|
|
Complement System
|
Inflammation/Immunology
|
|
C2 Protein (human) is a naturally glycosylated peptide with a 20 amino acid signal sequence. Complement component C2 functions as a key regulator in the early activation phase of the classical pathway and participates in the formation of the classical pathway C3 convertase C4b2a .
|
-
- HY-120833
-
|
|
Caspase
|
Others
|
|
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .
|
-
- HY-P1610
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Asudemotide (S-588410) is a peptide of human DEP domain-containing protein 1A. Asudemotide is an immunostimulant. Asudemotide has a sequence of H-Glu-Tyr-Tyr-Glu-Leu-Phe-Val-Asn-Ile-OH. Asudemotide induces a tumor immune response in esophageal cancer. .
|
-
- HY-P10251
-
|
|
HIV
|
Infection
|
|
HIV gp120 (318-327) is a short sequence of the HIV-1 strain IIIB envelope peptide (rgpgrafvti) that corresponds to the conserved C-terminal region of the glycoprotein. HIV gp120 (318-327) is part of the HIV vaccine V3 peptide epitope, also known as the I10 peptide. However, HIV gp120 (318-327) lacks the A2 anchor residues recognized by epitope-specific CTLs but has structural features that confer promiscuous A2 binding .
|
-
- HY-P3605
-
|
GAP (25-53), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (25-53), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 25-53 fragment (hGAP-25-53), can be used as immunogen to generate antiseras including MC-1, MC-2, and MC-3. GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
-
- HY-P2019
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus .
|
-
- HY-P4144
-
|
Phor18-LHRH (338613); EP-100
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Onvitrelin ucalontide ([Phor18-LHRH (338613)]) is an analogue of luteinizing hormone releasing hormone (LHRH) with antineoplastic activity. Onvitrelin ucalontide is a peptide with sequences of KFAKFAKKFAKFAKKFAKQHWSYGLRPG. Onvitrelin ucalontide effectively inhibits breast cancer, ovarian cancer and prostate cancer xenografts in mouse model .
|
-
- HY-P0323
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
-
- HY-P5439
-
|
|
PKC
MARCKS
|
Others
|
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P10790
-
|
|
Microtubule/Tubulin
|
Cancer
|
|
Breast cancer targeting peptide 18–4 is a KRT1 receptor-targeting peptide, with a Kd of 0.98 μM. The amino acid sequence of Breast cancer targeting peptide 18–4 is WxEAAYQrFL, and it is an analogue of P160 peptide (HY-P10789). When covalently conjugated with the anticancer peptide MccJ25, Breast cancer targeting peptide 18–4 significantly increases the cellular uptake of MccJ25 in breast cancer cells and enhances its anticancer activity. The covalent conjugate exhibits IC50 values of 14.2, 20, and 25 μM against MCF-7, MDA-MB-435, and MDA-MB-435-MDR cells, respectively .
|
-
- HY-P3325
-
|
D-P8RI
|
VEGFR
|
Inflammation/Immunology
|
|
P8RI (D-P8RI) is a biomimetic peptide of CD31 and a CD31 agonist. P8RI binds to the juxtamembrane amino acid sequence of the ectodomain of CD31, shows an immunosuppressive effect through restoration of the CD31 inhibitory pathway .
|
-
- HY-P11087
-
|
|
Collagen
|
Others
|
|
P15 is a collagen mimetic peptide with the sequence of GTPGPQGIAGQRGVV. P15 can mimic the cell-binding domain of human type I collagen. P15 is capable of promoting the adhesion, proliferation, and differentiation of osteoblasts. Biomaterials modified with P15 can be used in research related to bone regeneration .
|
-
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
-
- HY-P10786
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
LinTT1 peptide is a tumor-penetrating peptide with the amino acid sequence AKRGARST. LinTT1 peptide targets peritoneal carcinoma (PC) by binding to the p32 (gC1qR) receptor. It can conjugate with iron oxide nanoworms (NWs) to form a nanocarrier. This nanocarrier is taken up by peritoneal carcinoma cells in vitro and enters the mitochondria; it also exhibits significant tumor targeting and penetration effects in mice. Moreover, LinTT1-functionalized nanocarriers, combined with the pro-apoptotic peptide [D(KLAKLAK)2], show significant tumor suppression in a mouse peritoneal tumor model. LinTT1 peptide holds promise as a delivery carrier for peritoneal cancer research .
|
-
- HY-172283A
-
|
|
Liposome
|
Cancer
|
|
DSPE-PEG2000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283C
-
|
|
Liposome
|
Cancer
|
|
DSPE-PEG3400-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283
-
|
|
Liposome
|
Cancer
|
|
DSPE-PEG1000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283B
-
|
|
Liposome
|
Cancer
|
|
DSPE-PEG5000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-P10471
-
|
MARCKS-ED
|
MARCKS
PKC
|
Others
|
|
MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
-
- HY-P1115
-
|
|
Akt
|
Others
|
|
AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-P5472
-
|
|
Transmembrane Glycoprotein
|
Others
|
|
Tumour-associated MUC1 epitope is a biological active peptide. (This sequence is the hallmark of MUC1 mucin. MUC1 is a highly glycosylated type I transmembrane glycoprotein with a unique extracellular domain consisting of a variable number of tandem repeats (VNTR) of this 20 amino acid peptide. It is overexpressed on the cell surface of many human adenocarcinomas and hematological malignancies, including multiple myeloma and B-cell lymphoma, making MUC1 broadly applicable target for immunotherapeutic strategies.)
|
-
- HY-P10295
-
|
|
MDM-2/p53
|
Cancer
|
|
p53 (232-240) is a peptide segment of the 232-240 amino acid sequence of the human tumor suppressor protein p53. p53 (232-240) enhances its binding affinity to the Major histocompatibility complex (MHC), thereby enhancing the immunogenicity of this peptide to enhance the immune system's response to tumor antigens. p53 (232-240) can be used in the development of cancer vaccines and in the study of tumor cell recognition and clearance by the immune system .
|
-
- HY-P10055
-
|
PSMA-1
|
PSMA
|
Cancer
|
|
PSMA-1 is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells. PSMA-1 is selected and polyarginine sequences R6 or R9 were added at the C terminus to generate the CTPs. FITC labeling of the peptide with an aminohexanoic acid (Ahx) linker at the N terminus produced FITC-PSMA-1,to track PSMA binding on PCa cells .
|
-
- HY-P11219
-
|
|
YAP
|
Cancer
|
|
TAT-PDHPS1 is a YAP inhibitor composed of the endogenous peptide PDHPS1 and the cell-penetrating peptide sequence TAT. PDHPS1 binds to protein phosphatase 2 phosphatase activator (PTPA), an essential activator of protein phosphatase 2A (PP2A), leading to increased YAP phosphorylation, which inactivates YAP and suppresses the expression of its downstream target genes. TAT-PDHPS1 is potentially useful in ovarian cancer research .
|
-
- HY-P4307
-
|
|
SARS-CoV
|
Infection
|
|
Antioxidant agent-9 is a peptide with the sequence Asp-Trp. Antioxidant agent-9 shows antioxidant activity. Antioxidant agent-9 also is potential as SARS-CoV-2 antiviral, with an affinity strength equal to Chloroquine (HY-17589A) and Favipiravir (HY-14768) .
|
-
- HY-P10388
-
|
|
CD47
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
-
- HY-P10601
-
-
- HY-137858
-
|
Gly-Arg-4-NA hydrochloride; GR-pNA hydrochloride; GR p-itoailide hydrochloride
|
Fluorescent Dye
|
Others
|
|
H-Gly-Arg-pNA hydrochloride (GR-pNA hydrochloride) is a colorimetric substrate for thrombin. H-Gly-Arg-pNA is preferentially bound by thrombin and cleaves the Gly-Arg (GR) peptide sequence, releasing p-nitroaniline (pNA) that can be detected colorimetrically at 405 nm. H-Gly-Arg-pNA hydrochloride is used as a fluorescent dye to measure thrombin activity .
|
-
- HY-P10601A
-
-
- HY-P2929B
-
|
|
Glycosidase
|
Cancer
|
|
PNGase F (Immobilized, Microspin) is a resin in which the PNGase F (peptide N-glycosidase F) enzyme is covalently coupled to agarose beads for the removal of N-glycans from antibodies, fusion proteins, and other N-glycosylated proteins. The enzyme is recombinantly expressed in E.coli and the sequence is derived from Flavobacterium meningsepticum .
|
-
- HY-P1115A
-
|
|
Akt
|
Others
|
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
-
- HY-P10792
-
|
|
EGFR
|
Cancer
|
|
HER2-targeted peptide H6F is a HER2 targeting peptide that binds to HER2 to target breast cancer cells, with the amino acid sequence YLFFVFER. The HER2-targeted peptide H6F can be conjugated with the bifunctional chelating agent hydrazinonicotinamide (HYNIC) for radiolabeling with 99mTc. Single-photon emission computed tomography (SPECT) imaging shows that the labeled HER2-targeted peptide H6F specifically accumulates in HER2-positive MDA-MBA-453 tumor-bearing mice models. The HER2-targeted peptide H6F can be used for tumor molecular imaging studies .
|
-
- HY-P11204
-
|
|
Peptide-Drug Conjugates (PDCs)
|
Others
|
|
DDDEEKC is a bioinspired peptide sequence that can selectively adsorb onto the enamel surface (mimicking the role of salivary acquired pellicle protein statherin), acting as a "target - guiding agent" for tooth enamel remineralization. DDDEEKC enhances the regeneration of hydroxyapatite (HAP). DDDEEKC is promising for research of in-situ remineralization repair of enamel demineralization damage (such as dental caries) .
|
-
- HY-P0323A
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41) TFA, a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus. GP(33-41) TFA can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
-
- HY-162832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid-β-IN-1 (compound 13) is a synthetic peptide containing the hydrophobic C-terminal region "VVIA-NH2" and its reverse sequence "AIVV-NH2" of Aβ42, which is an Aβ inhibitor. Amyloid-β-IN-1 can inhibit Aβ aggregation and has neuroprotective effects .
|
-
- HY-P10405
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide is a selective D1-D2 heterogeneous antagonist. TAT-D1 peptide destroys the heterodimer of the D1-D2 receptor by interacting with the specific domain of the D2 receptor through its unique amino acid sequence, in particular the two glutamate residues at the C terminal of the D1 receptor. TAT-D1 peptide can be used to study the role of D1-D2 receptor heterodimers in the regulation of depressive and anxiety-like behaviors .
|
-
- HY-D2439
-
|
|
Fluorescent Dye
|
Cancer
|
|
RGD-PEG-Cy3 is a fluorescent labeling reagent that combines Cy3 fluorescent dye, peptide (RGD) and polyethylene glycol (PEG). The Cy3 fluorophore is commonly used in applications such as immunolabeling, nucleic acid labeling, fluorescence microscopy, and flow cytometry. Cy3 has an emission maximum around 562-570 nm. RGD is a peptide sequence (CRGDKGPDCiRGD) that binds to αvβ3 and αvβ5 integrin receptors on tumor neovasculogenesis to achieve specific tumor tissue targeting .
|
-
- HY-P5461
-
|
|
Bacterial
|
Others
|
|
CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
|
-
- HY-P10702
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p1 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10703) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p1 is promising for the development of nanomaterials in the biomedical field .
|
-
- HY-P10703
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p2 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10702) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p2 is promising for the development of nanomaterials in the biomedical field .
|
-
- HY-P10661
-
|
|
Biochemical Assay Reagents
|
Others
|
|
L-KYFIL is a pentapeptide that is amorphous on its own. When mixed with D-KYFIL, it transforms from fibrous hydrogels into plate-like networks, resulting in changes in mechanical properties and forming a crystalline state. The mixture can protect L-KYFIL from proteolytic degradation. L-KYFIL can be used to study stereocomplexation behavior of peptide sequences and in the development of biomaterials .
|
-
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P5325A
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) (acetate) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-E70018
-
|
|
Endogenous Metabolite
|
Infection
Metabolic Disease
|
|
Picornain 3C is a protease found in picornaviruses, which cleaves peptide bonds of non-terminal sequences. Picornain 3C is an intermediate between the serine peptidase chymotrypsin and the cysteine peptidase papain. Picornain 3C shows endopeptidase activity by selectively cleaving Gln-Gly bonds in the polyprotein of poliovirus and with substitution of Glu for Gln, and Ser or Thr for Gly in other picornaviruses .
|
-
- HY-P4873
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Amylin (20-29) (human) is the fragment of human islet amyloid polypeptide (hIAPP) or Amylin. Amylin is a 37-residue hormone. Amylin (20-29) (human) is responsible for the amyloidogenic propensities of the full length protein. Amylin (20-29) (human) can be transformed into its corresponding peptoid and retropeptoid sequences, to obtain beta-sheet breaker peptides as amyloid inhibitors .
|
-
- HY-E70393J
-
|
|
Factor XI
|
Others
|
|
Bovine Factor XIa is an enzyme, which is involved in the intrinsic pathway of blood coagulation. Bovine Factor XIa is highly selective and exhibits a minimal extended substrate recognition site of at least five residues long. Bovine Factor XIa is reactive as Bovine Factor IXa (HY-E70393I) does, that it cleaves all the peptides bearing factor IX activation site sequences .
|
-
- HY-P10471A
-
|
MARCKS-ED TFA
|
MARCKS
PKC
|
Others
|
|
MPSD TFA (MARCKS-ED TFA) is the TFA salt form of MPSD (HY-P10471). MPSD TFA is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD TFA can sense membrane curvature and recognize phosphatidylserine. MPSD TFA can be utilized as biological probe to study membrane shape and lipid composition .
|
-
- HY-126402
-
|
|
Integrin
|
Cancer
|
|
Arg-Gly-Asp (RGD) is a synthetic peptide corresponding to the cell adhesion sequence for the integrins αVβ1, αVβ3, αVβ5, αVβ6, αVβ8, α8β1, and α5β1. It is a component of radioligands and peptidomimetics that have been used in the study of integrin expression and activity in vivo.
|
-
- HY-112295
-
|
|
Biochemical Assay Reagents
|
Infection
|
|
AzKTB is a capture reagent which bears a short trypsin-cleavable peptide sequence between the azide module and the TAMRA/PEG-biotin labels. AzKTB is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.
|
-
- HY-P3726
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Lys-Gln-Ala-Gly-Asp-Val (KQAGDV) is the six most carboxyl-terminal amino acids in the fibrinogen γ-chain sequence. Lys-Gln-Ala-Gly-Asp-Val is a cell adhesion peptide which is mediated through the α2bβ3 integrin. Lys-Gln-Ala-Gly-Asp-Val is a potent adhesion ligand for smooth muscle cells (SMCs) .
|
-
- HY-P1906
-
|
|
CDK
|
Neurological Disease
|
|
[pThr3]-CDK5 Substrate is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
-
- HY-P1906A
-
|
|
CDK
|
Neurological Disease
|
|
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
-
- HY-P5485
-
|
|
Bacterial
|
Others
|
|
Dabcyl-QALPETGEE-Edans is a synthetic peptide substrate for fluorescence resonance energy transfer (FRET) detection of Sortase A (SrtA) enzymatic activity. Dabcyl-QALPETGEE-Edans is labeled at both ends with the fluorescent group Edans (donor) and the quencher Dabcyl (acceptor), respectively. Dabcyl-QALPETGEE-Edans's central sequence contains a conserved motif specifically recognized by SrtA. Dabcyl-QALPETGEE-Edans demonstrates high sensitivity in vitro assays, enabling precise determination of the half-maximal inhibitory concentration of SrtA .
|
-
- HY-P10417
-
|
|
Integrin
|
Others
Cancer
|
|
RTDLDSLRTYTL is an Alpha (v) beta (6) integrin (avb6) inhibitor with high affinity and specificity. RTDLDSLRTYTL binds to avb6 integrin, a peptide sequence that activates cytotoxicity and cytokine production in T cells, such as interferon-gamma. RTDLDSLRTYTL is designed through a chimeric T cell antigen receptor (CAR) so that T cells can be redirected to specifically recognize and attack tumor cells. RTDLDSLRTYTL can be used in the research of cancer immunotherapy and targeted drug development .
|
-
- HY-P11208
-
|
|
GABA Receptor
|
Inflammation/Immunology
|
|
mNLS-CPP-WSTF is a nuclear localization signal (NLS)-cell-penetrating peptide based on the mouse WSTF sequence. mNLS-CPP-WSTF significantly inhibits the GABARAP-WSTF interaction, WSTF degradation and inflammatory gene expression. mNLS-CPP-WSTF effectively attenuates chronic inflammation, liver fibrosis and cartilage damage in metabolic-dysfunction-associated steatohepatitis (MASH) and osteoarthritis (OA) mice model. mNLS-CPP-WSTF is promising for research of chronic inflammatory diseases such as MASH and OA .
|
-
- HY-E70565
-
|
|
Endonuclease
|
Inflammation/Immunology
|
O-Glycoprotease is an O-glycoprotein-specific endoprotease that catalyzes the hydrolysis of peptide bonds directly adjacent to the O-polymer in native mucin-type O-glycosylated proteins. O-Glycoprotease sequence is from Akkermansia muciniphila, recombinantly expressed in E.coli, with a 6×His tag at the C-terminus.
The enzyme maintains high activity between pH 5.5-7.5 and is resistant to 1M NaCl, but is highly sensitive to EDTA (0.5 mM EDTA) and can be inhibited by Zn 2+.
|
-
- HY-P990088
-
|
|
VEGFR
PD-1/PD-L1
|
Cardiovascular Disease
|
|
Sotiburafusp alfa is a bispecific fusion protein, which is a humanized VEGFR-1 extracellular domain fragment (129-228, 1-100 in the current sequence) fused via the peptide linker 101GGSGGSGGSGGSGGS 115 to the N-terminus of the heavy chain (116-564) of a humanized IgG1-kappa anti-human PD-L1 heavy chain variant L352>A, L353>A. Sotiburafusp alfa is also an angiogenesis inhibitor .
|
-
- HY-151678
-
|
|
ADC Linker
|
Others
|
|
N3-L-Lys(Mtt)-OH is a click chemistry reagent containing an azide group. N3-L-Lys(Mtt)-OH can introduce azide functions into the amino acid building block of peptide sequences at the N-terminal position. It contains an azide group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing alkyne groups. It can also undergo ring strain-promoted alkyne-azide cycloaddition (SPAAC) with molecules containing DBCO or BCN groups.
|
-
- HY-P10553
-
|
|
Apoptosis
|
Cancer
|
|
ARF(26–44), cell-permeable is a cell-penetrating peptide derived from a specific amino acid sequence of the p14ARF tumor suppressor protein. As a functional inhibitor of FoxM1, ARF(26–44) cell-permeable shows significant anti-tumor activity in the treatment of mouse hepatocellular carcinoma (HCC), significantly increasing tumor cell apoptosis and reducing tumor cell proliferation and angiogenesis. ARF(26–44), cell-permeable can be used in research on tumor therapy .
|
-
- HY-P2307
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
- HY-P2307A
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
-
- HY-151780
-
|
|
ADC Linker
|
Others
|
|
Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent containing an azide group. Fmoc-L-Dap(Pentynoyl)-OH serves as an amino acid building block for introducing alkyne functions into peptide sequences by standard Fmoc/tBu protocols. The alkyne residue can be engaged for copper catalyzed click reaction with organic azides or with tetrazines for copper-free conjugations . Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-P11208C
-
|
|
GABA Receptor
|
Inflammation/Immunology
|
|
mNLS-CPP-WSTF TFA is the trifluoroacetate salt of mNLS-CPP-WSTF (HY-P11208). mNLS-CPP-WSTF is a nuclear localization signal (NLS)-cell-penetrating peptide based on the mouse WSTF sequence. mNLS-CPP-WSTF significantly inhibits the GABARAP-WSTF interaction, WSTF degradation and inflammatory gene expression. mNLS-CPP-WSTF effectively attenuates chronic inflammation, liver fibrosis and cartilage damage in metabolic-dysfunction-associated steatohepatitis (MASH) and osteoarthritis (OA) mice model. mNLS-CPP-WSTF is promising for research of chronic inflammatory diseases such as MASH and OA .
|
-
- HY-P5558
-
|
|
VEGFR
|
Neurological Disease
|
|
KLTWQELYQLKYKGI is a VEGF mimetic peptide designed based on the VEGF helix sequence 17-25, with the ability to activate VEGF receptors and exert pro-angiogenic biological activity. KLTWQELYQLKYKGI effectively promotes the attachment, spreading and proliferation of human umbilical vein endothelial cells. KLTWQELYQLKYKGI enhances the proliferation, migration and osteogenic differentiation of bone marrow stromal cells (BMSCs). KLTWQELYQLKYKGI synergistically accelerates angiogenesis and bone regeneration in rat cranial defect models. KLTWQELYQLKYKGI can be used for the research of brain tissue engineering and traumatic brain injury repair and biomaterials for bone tissue engineering and bone repair .
|
-
- HY-P10464
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
-
- HY-19307
-
|
|
Integrin
Interleukin Related
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
Cancer
|
|
SB-273005 is an orally active non-peptide αvβ3 integrin antagonist with Ki values of 1.2 nM and 0.3 nM for αvβ3 and αvβ5, respectively. SB-273005 blocks the binding of integrins to the RGD sequence in the extracellular matrix. SB-273005 inhibits Rictor phosphorylation and reduces IL-10 secretion. SB-273005 inhibits inflammation, prevents bone loss, regulates vascular smooth muscle function, and reverses pregnancy-induced immune deviation. SB-273005 can be used in the study of rheumatoid arthritis, osteoporosis, and aneurysms. .
|
-
| Cat. No. |
Product Name |
Type |
-
- HY-137858
-
|
Gly-Arg-4-NA hydrochloride; GR-pNA hydrochloride; GR p-itoailide hydrochloride
|
Dyes
|
|
H-Gly-Arg-pNA hydrochloride (GR-pNA hydrochloride) is a colorimetric substrate for thrombin. H-Gly-Arg-pNA is preferentially bound by thrombin and cleaves the Gly-Arg (GR) peptide sequence, releasing p-nitroaniline (pNA) that can be detected colorimetrically at 405 nm. H-Gly-Arg-pNA hydrochloride is used as a fluorescent dye to measure thrombin activity .
|
-
- HY-D2439
-
|
|
Fluorescent Dyes/Probes
|
|
RGD-PEG-Cy3 is a fluorescent labeling reagent that combines Cy3 fluorescent dye, peptide (RGD) and polyethylene glycol (PEG). The Cy3 fluorophore is commonly used in applications such as immunolabeling, nucleic acid labeling, fluorescence microscopy, and flow cytometry. Cy3 has an emission maximum around 562-570 nm. RGD is a peptide sequence (CRGDKGPDCiRGD) that binds to αvβ3 and αvβ5 integrin receptors on tumor neovasculogenesis to achieve specific tumor tissue targeting .
|
| Cat. No. |
Product Name |
Type |
-
- HY-172714A
-
|
|
Drug Delivery
|
|
DSPE-PEG3400-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172714
-
|
|
Drug Delivery
|
|
DSPE-PEG2000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172713
-
|
|
Drug Delivery
|
|
DSPE-PEG1000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172715
-
|
|
Drug Delivery
|
|
DSPE-PEG5000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-NP202
-
|
|
Native Proteins
|
|
C2 Protein (human) is a naturally glycosylated peptide with a 20 amino acid signal sequence. Complement component C2 functions as a key regulator in the early activation phase of the classical pathway and participates in the formation of the classical pathway C3 convertase C4b2a .
|
-
- HY-172283A
-
|
|
Drug Delivery
|
|
DSPE-PEG2000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283C
-
|
|
Drug Delivery
|
|
DSPE-PEG3400-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283
-
|
|
Drug Delivery
|
|
DSPE-PEG1000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283B
-
|
|
Drug Delivery
|
|
DSPE-PEG5000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P3460A
-
-
- HY-P3051
-
|
|
Reverse Transcriptase
|
Inflammation/Immunology
|
|
CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
|
-
- HY-P5217
-
|
|
Peptides
|
Others
|
|
CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
|
-
- HY-P3287
-
|
|
Peptides
|
Others
|
|
UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .
|
-
- HY-P3460
-
-
- HY-P10116
-
|
APTscr-9R
|
STAT
|
Others
|
|
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
|
-
- HY-P1138
-
|
FSVYWAQADR
|
Gap Junction Protein
|
Others
|
|
Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
|
-
- HY-P2665
-
|
|
Peptides
|
Others
|
|
Lymphocyte activating pentapeptide is a short peptide sequence found in the Fc region of human IgG1 that has the ability to activate lymphocytes. Lymphocyte activating pentapeptide can be used to study the activation mechanisms of B cells and T cells, and their role in immune responses .
|
-
- HY-P10593
-
|
|
Transmembrane Glycoprotein
Influenza Virus
|
Cancer
|
|
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
|
-
- HY-P3956
-
|
|
Peptides
|
Others
|
|
Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide .
|
-
- HY-P11088
-
-
- HY-P5394
-
|
|
Peptides
|
Others
|
|
Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
|
-
- HY-P0329
-
|
|
Peptides
|
Others
|
|
X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.
|
-
- HY-P4132
-
|
|
Peptides
|
Cancer
|
|
Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .
|
-
- HY-P1965
-
|
|
Peptides
|
Cancer
|
|
Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
|
-
- HY-P1963
-
|
|
Peptides
|
Cancer
|
|
Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.
|
-
- HY-P1964
-
|
|
Peptides
|
Cancer
|
|
Ac-IEVDIDVE TFA is a short peptide sequence with Ac at the end.
|
-
- HY-P1966
-
|
|
Peptides
|
Cancer
|
|
Ac-IEVDID TFA is a short peptide sequence with Ac at the end.
|
-
- HY-P1967
-
|
|
Peptides
|
Cancer
|
|
Ac-VDID TFA is a short peptide sequence with Ac at the end.
|
-
- HY-P4093
-
-
- HY-P10190
-
|
|
Peptides
|
Others
|
|
CADY is a cell-penetrating peptide (CPPs) peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .
|
-
- HY-P10156
-
|
Cell-penetrating peptide MAP17
|
Peptides
|
Others
|
|
MAP17 (Cell-penetrating peptide MAP17) is a synthetic secondary amphipathic cell-penetrating peptides, with sequence of QLALQLALQALQAALQLA .
|
-
- HY-P2361
-
|
|
Ras
|
Others
|
|
S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .
|
-
- HY-P2193
-
|
|
Peptides
|
Infection
|
|
TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
-
- HY-P1908
-
-
- HY-P2641
-
|
|
MMP
|
Cancer
|
|
Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
|
-
- HY-P5119
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P5119A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P2193A
-
|
|
Peptides
|
Infection
|
|
TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
|
-
- HY-P3526
-
-
- HY-P3818
-
|
|
PKC
|
Others
|
|
PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
|
-
- HY-P1870
-
-
- HY-P1517
-
-
- HY-P4872
-
|
|
Peptides
|
Neurological Disease
|
|
Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP .
|
-
- HY-P5118
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P10187
-
|
|
Peptides
|
Others
|
|
α-Casein (90-96) is a peptide with sequence of Arg-Tyr-Leu-Gly-Tyr-Leu-Glu .
|
-
- HY-P10158
-
|
Porcine cathelicidin PMAP-36
|
Bacterial
|
Infection
|
|
PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
|
-
- HY-P1311
-
|
|
Drug Isomer
|
Others
|
|
RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
|
-
- HY-P0315
-
|
|
Akt
|
Others
|
|
Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
|
-
- HY-P1734
-
|
|
PKC
|
Neurological Disease
|
|
Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .
|
-
- HY-P11355
-
|
|
Peptides
|
Cancer
|
|
KRAS WT Peptide is the normal sequence peptide of the Kirsten rat sarcoma virus (KRAS) gene without oncogenic mutations. KRAS WT Peptide can be used for the study of evaluating the specificity and safety of KRAS-targeted immunotherapies .
|
-
- HY-P5353
-
|
IKVAV sequence; Laminin A-chain fragment
|
Peptides
|
Others
|
|
PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)
|
-
- HY-P10787
-
|
|
Complement System
|
Cancer
|
|
tLyP-1 peptide is an NRP-1 targeting peptide with an IC50 of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .
|
-
- HY-P10651
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
|
-
- HY-P10020
-
|
hTERT (660–689)
|
Peptides
|
Cancer
|
|
Alrefimotide is a hTERT-derived immunogenic peptide. Alrefimotide has a sequence of ALFSVLNYERARRPGLLGASVLGLDDIHRA. Alrefimotide can be used in cancer immunotherapy research .
|
-
- HY-P4054
-
|
|
Peptides
|
Others
|
|
IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering
|
-
- HY-P4425
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .
|
-
- HY-P5118A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P10778
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .
|
-
- HY-P10709
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Cancer
|
|
CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
- HY-P10709A
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Cancer
|
|
CREKA peptide acetate is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide acetate can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
- HY-P5343
-
|
p53 Consensus binding sequence
|
MDM-2/p53
|
Others
|
|
p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)
|
- HY-P10471E
-
|
MARCKS-ED control peptide TFA
|
MARCKS
|
Others
|
|
MPSD control peptide (MARCKS-ED control peptide) TFA is the control peptide of MPSD (HY-P10471). MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS) .
|
- HY-P1364
-
|
|
iGluR
|
Neurological Disease
|
|
Pep1-AGL is a peptide with the sequence of SSGMPLGAAGL. Pep1-AGL serves as the control peptide for Pep1-TGL (HY-P1367) .
|
- HY-P11355A
-
|
|
Peptides
|
Cancer
|
|
KRAS WT Peptide TFA is the trifluoroacetate salt of KRAS WT Peptide (HY-P11355). KRAS WT Peptide is the normal sequence peptide of the Kirsten rat sarcoma virus (KRAS) gene without oncogenic mutations. KRAS WT Peptide can be used for the study of evaluating the specificity and safety of KRAS-targeted immunotherapies .
|
- HY-P3702
-
|
|
TRP Channel
|
Others
|
|
CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1 .
|
- HY-P4081
-
|
|
Peptides
|
Others
|
|
Plsl is a cell-penetrating peptide (CPP), with sequence of RVIRVWFQNKRCKDKK. Plsl, belongs to Penetralia family, and origins from Igl-1 homeodomain .
|
- HY-P4130
-
|
|
Peptides
|
Cancer
|
|
MPS-Gαi2 is a peptide (membrane-permeable sequence). MPS-Gαi2 can be used for the research of cell adhesion .
|
- HY-P5514
-
|
Amylin (22-27) [NMeG24, NMeI26], human (IAPP)
|
Peptides
|
Others
|
|
NF(N-Me)GA(N-Me)IL is a biological active peptide. (This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis.)
|
- HY-P3211B
-
|
LR12-scr
|
TREM receptor
|
Inflammation/Immunology
|
|
Nangibotide scrambled peptide (LR12-scr) is a scrambled control peptide composed of the same amino acids from LR12 (Nangibotide; HY-P3211) but in a random sequence (YQDVELCETGED) .
|
- HY-P5526
-
|
|
Casein Kinase
|
Others
|
|
CCK1-specific peptide substrate is a biological active peptide. (This peptide sequence is based on rabbit muscle glycogen synthase with Ser7 phosphorylated. It is a peptide substrate for Casein Kinase I (CK1). CK1 phosphorylates Ser10. Ser7 is phosphorylated by PKA in vivo.)
|
- HY-P10610
-
|
|
MDM-2/p53
|
Cancer
|
|
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
|
- HY-P10739
-
|
|
MMP
|
Inflammation/Immunology
|
|
WYRGRL, a collagen II-targeting peptide, can bind to collagen II α1. WYRGRL is a short cartilage-targeting peptide sequence. WYRGRL leads to about 72-fold increase of cartilage-targeting efficiency for the peptide-functionalized nanoplatform in vivo .
|
- HY-P5516
-
|
|
Peptides
|
Others
|
|
SNNF(N-Me)GA(N-Me)IL is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)
|
- HY-P10147
-
|
|
Caspase
|
Cancer
|
|
Ac-LDESD-AMC is a caspase-2 inhibitor. Ac-LDESD-AMC has a peptide sequence of Leu-Asp-Glu-Ser-Asp .
|
- HY-P3523
-
|
|
Integrin
|
Others
|
|
KGDS is synthetic peptides, targeting integrin GPIIb-IIIa located on the membrane of human activated platelets. Amino acid sequence: Lys-Gly-Asp-Ser .
|
- HY-P5517
-
|
|
Peptides
|
Others
|
|
SNNF(N-Me)GA(N-Me)ILSS is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)
|
- HY-136727
-
|
|
Caspase
|
Cancer
|
|
Ac-LEVD-CHO is a caspase-4 inhibitor. Ac-LEVD-CHO is a peptide with the sequence of Ac-Leu-Glu-Val-Asp-al .
|
- HY-P5124
-
|
KLVFF
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid peptide(16-20) is a amino acid sequences (KLVFF) of Amyloid-β (Abeta). β-Amyloid peptide(16-20) is an effective inhibitor of Abeta fibril formation, with RG-/-GR-NH2 residues added at N- and C-terminal ends to aid solubility) .
|
- HY-P5515
-
|
|
Peptides
|
Others
|
|
F(N-Me)GA(N-Me)IL is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence were found to be devoid of β-sheet structure, amyloidogenicity and cytotoxicity, The derivatives were able to interact with the native sequences and inhibit amyloid formation)
|
- HY-P5433
-
|
|
Peptides
|
Others
|
|
IRS1-derived peptide is a biological active peptide. (This is a peptide fragment (979-989) of the insulin receptor substrate-1 containing the sequence motif YMXM known to bind to the two domains of SH2 on the 85kDa subunit of phosphoinositide 3-kinase.)
|
- HY-P1781
-
|
|
Peptides
|
Cancer
|
|
Peptide C105Y, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .
|
- HY-P1311A
-
- HY-P4097
-
|
|
Peptides
|
Others
|
|
293P-1 is a peptide with tissue-specific homing properties. 293P-1 is specific for hepatocytes with sequences of SNNNVRPIHIWP .
|
- HY-P3732
-
|
|
Integrin
|
Cancer
|
|
RGD-4C is a arginine-glycine-aspartic acid peptide (ACDCRGDCFC) with integrin binding activity. The Arg-Gly-Asp (RGD) sequence serves as the primary integrin recognition site in extracellular matrix proteins, and peptides containing this sequence can mimic the recognition specificity of the matrix proteins. RGD-4C is a αv-integrin ligand, can conjugate with bioactive molecule to exert antitumor effects in animal models .
|
- HY-P1781A
-
|
|
Secretin Receptor
|
Cancer
|
|
Peptide C105Y TFA, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .
|
- HY-P2162
-
|
|
Myosin
|
Cancer
|
|
Kemptamide, a 13 amino acid fragment with a sequence corresponding to residues 11-23 of gizzard light chain. Kemptamide is a peptide substrate of myosin light-chain kinase (MLCK) .
|
- HY-P2480
-
|
|
CDK
|
Others
|
|
Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDK, can be used to detecting CDK1-cyclinB1 enzyme activity .
|
- HY-P4145
-
|
|
Peptides
|
Inflammation/Immunology
Cancer
|
|
Quazomotide is a WT1 class II peptide epitope with sequences of RSDELVRHHNMHQRNMTKL. Quazomotide stimulates a peptide-specific CD4(+) response, to recognize WT1(+) tumor cells. Quazomotide is an immunological agent for active immunization, as well as an antineoplastic agent .
|
- HY-P5427
-
|
|
Peptides
|
Others
|
|
EAC3I is a biological active peptide. (The autocamtide-3 derived inhibitory peptide (EAC3I) sequence (KKALHRQEAVDAL) mimics the autoinhibitory region of the CaMKII regulatory domain (residues 278–290) and acts by competitively binding to the catalytic site.)
|
- HY-P10705
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
KGFRWR is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. KGFRWR can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .
|
- HY-P5430
-
|
|
DYRK
|
Others
|
|
DYRKtide is a biological active peptide. (Dyrktide is designed as the optimal substrate sequence efficiently phosphorylated by DYRK1A, which is a dual-specificity protein kinase that is thought to be involved in brain development.)
|
- HY-P10179
-
- HY-W101305
-
|
|
Amino Acid Derivatives
|
Others
|
|
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .
|
- HY-P10422
-
|
ML-peptide, Multi-Leucine (ML)-peptide
|
Autophagy
|
Cancer
|
|
Multi-Leu peptide (ML-peptide) is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
|
- HY-P3752
-
|
|
Peptides
|
Others
|
|
Gly-Ala-Tyr is a tripeptide composed of L-glycine, alanine and L-tyrosine joined in sequence by peptide linkages. Ala-Gly-Tyr is functionally related to L-alanine, glycine and L-tyrosine.
|
- HY-P0144
-
|
|
CD47
Apoptosis
|
Inflammation/Immunology
|
|
Thrombospondin-1 (1016-1023) (human, bovine, mouse), is the C-terminal end of the native sequence of Thrombospondin-1 (TSP-1), is a CD47 agonist peptide .
|
- HY-P5444
-
|
|
Bacterial
|
Others
|
|
Drosocin is a biological active peptide. (Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.)
|
- HY-P5832
-
|
|
Peptides
|
Others
|
|
BMP2-derived peptide is a functional motif from positions 73 to 92 of the amino acid sequence of BMP-2. BMP2-derived peptide promotes osteogenic differentiation of bone marrow stromal cells (BMSCs) and enhances bone regeneration .
|
- HY-P3606
-
|
GAP (1-24), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (1-24), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 1-24 fragment (hGAP-1-24). GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
- HY-P1507
-
|
|
Integrin
|
Cardiovascular Disease
|
|
Fibrinogen Binding Inhibitor Peptide is a dodecapeptide (HHLGGAKQAGDV, H12), which is a fibrinogen γ-chain carboxy-terminal sequence (γ400-411). Fibrinogen Binding Inhibitor Peptide is a specific binding site of the ligand for activated glycoprotein (GP) IIb/IIIa.
|
- HY-P5483
-
|
|
Bacterial
|
Others
|
|
Retro-indolicidin is a biological active peptide. (Reverse peptide of indolicidin (Rev4) is a 13-amino acid residue peptide based on the sequence of indolicidin. Indolicidin, a member of the cathelicidin protein family, is a 13-amino acid residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. The synthetic peptide Rev4 has been shown to possess strong antimicrobial as well as protease inhibitory activities in vitro.)
|
- HY-P10471D
-
|
MARCKS-ED control peptide
|
MARCKS
PKC
|
Others
|
|
MPSD control peptide (MARCKS-ED control peptide) is a control peptide for MPSD peptide (HY-P10471). MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
- HY-P10422A
-
|
ML-peptide, Multi-Leucine (ML)-peptide triacetate
|
Autophagy
|
Cancer
|
|
Multi-Leu peptide (ML-peptide) triacetate is a potent inhibitor of PACE4 (Ki=22 nM). Multi-Leu peptide triacetate can competitively bind to the active site of PACE4 by simulating the substrate sequence of PACE4, thereby inhibiting its catalytic activity. Multi-Leu peptide triacetate can be used to study the specific mechanism of PACE4 in the development of prostate cancer .
|
- HY-P1566
-
|
|
HIV
|
Infection
|
|
MPG, HIV related is 27-aa peptide, derived from both the nuclear localisation sequence of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41 and is a potent delivery agent for the generalised delivery of nucleic acids and of oligonucleotides into cultured cells.
|
- HY-P4104
-
|
|
Peptides
|
Others
|
|
pVEC (Cadherin-5) is a cell-penetrating 18-amino acid-long peptide derived from the murine sequence of the cell adhesion molecule vascular endothelial cadherin. pVEC (Cadherin-5) is efficiently and rapidly taken up into cells, it can be used as a carrier peptide .
|
- HY-P0202
-
- HY-P1183
-
|
|
Peptides
|
Neurological Disease
Endocrinology
|
|
Locustatachykinin I is a insect tachykinin-related peptide isolated from Locusta migratoria. Locustatachykinin I exhibits sequence homologies with the vertebrate tachykinins. In Lacanobia, Locustatachykinin I is also a substrate for a deamidase .
|
- HY-P10788
-
|
|
Complement System
|
Cancer
|
|
CK3 peptide is an NRP-1 targeting peptide with the amino acid sequence CLKADKAKC. The CK3 peptide specifically binds to NRP-1 to target breast cancer cells. Single-photon emission computed tomography (SPECT) and near-infrared fluorescence (NIRF) imaging show significant accumulation of CK3 peptide in xenograft tumors in nude mice. CK3 peptide can be used for molecular imaging studies of breast cancer.
|
- HY-P11000
-
|
|
Biochemical Assay Reagents
|
Others
|
|
INF7TAT is an amphipathic peptide containing the influenza HA2 sequence and the TAT peptide (HY-P0281). INF7TAT can associate with other macromolecules through non-covalent associations. INF7TAT can be used for non-toxic delivery of siRNAs .
|
- HY-P0202A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human) (TFA) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P0306
-
|
Heparin Binding peptide
|
Peptides
|
Cardiovascular Disease
|
|
Fibronectin Adhesion-promoting Peptide (Heparin Binding Peptide) is one of the heparin-binding amino acid sequences found in the carboxy-terminal heparin-binding domain of fibronectin. It promotes assembly of mesenchymal stem cell (MSC) spheroids into larger aggregates. Fibronectin Adhesion-promoting Peptide directly promotes the adhesion, spreading, and migration of endothelial cells by reacting with heparin binding domains of cells .
|
- HY-P0306A
-
|
Heparin Binding peptide TFA
|
Peptides
|
Cardiovascular Disease
|
|
Fibronectin Adhesion-promoting Peptide (Heparin Binding Peptide) is one of the heparin-binding amino acid sequences found in the carboxy-terminal heparin-binding domain of fibronectin. It promotes assembly of mesenchymal stem cell (MSC) spheroids into larger aggregates. Fibronectin Adhesion-promoting Peptide directly promotes the adhesion, spreading, and migration of endothelial cells by reacting with heparin binding domains of cells .
|
- HY-P0139
-
|
|
Gap Junction Protein
|
Cardiovascular Disease
|
|
Gap 27, a synthetic connexin43 mimetic peptide, is a gap junction inhibitor. Gap 27 possesses conserved sequence homology to a portion of the second extracellular loop leading into the fourth transmembrane connexin segment .
|
- HY-P2365
-
|
|
Fungal
|
Infection
|
|
Histatin-8 is a part of the Histatin-3 central sequence and is known as hemagglutination-inhibiting peptide. Histatin-8 is a potent anti-fungal peptide. Histatin-8 shows antimicrobial activity against yeast strains. Histatin-8 can be used for oral thrush research .
|
- HY-P11286
-
|
|
Peptides
|
Cancer
|
|
A7RC is a multifunctional peptide used in tumor-targeted therapy, with Cysteine added to the C-terminal of the A7R peptide (sequence: ATWLPPR). A7R (HY-P1663) is a ligand of the NRP-1 receptor, regulating intracellular signal transduction related to tumor vascularization and tumor growth .
|
- HY-P1183A
-
|
|
Peptides
|
Neurological Disease
Endocrinology
|
|
Locustatachykinin I TFA is a insect tachykinin-related peptide isolated from Locusta migratoria. Locustatachykinin I TFA exhibits sequence homologies with the vertebrate tachykinins. In Lacanobia, Locustatachykinin I TFA is also a substrate for a deamidase .
|
- HY-P2039
-
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
- HY-P11094
-
|
|
TET Protein
|
Neurological Disease
|
|
Tet1 is a peptide with the sequence of HLNILSTLWKYRC. Tet1 can specifically bind to the neuronal ganglioside receptor GT1b and possesses neuronal targeting ability. Tet1 can be used in research related to drug delivery .
|
- HY-P1312
-
- HY-P4149
-
- HY-P4041
-
|
|
Peptides
|
Others
|
|
[Ala127] Hepatitis B Virus Pre-S Region (120-131) is a peptide with the sequence of MQWNSTAFHQT. [Ala127] Hepatitis B Virus Pre-S Region (120-131) can be used in the activity enhancement study .
|
- HY-P5344
-
|
Fluorigenic PEXEL peptide
|
Parasite
|
Others
|
|
Dabcyl-LNKRLLHETQ-Edans (Fluorigenic PEXEL peptide) is a biological active peptide. (This FRET substrate peptide for Plasmepsin V (PMV) is derived from the conserved Plasmodium Export Element (PEXEL) motif of Histidine-Rich Protein II (HRPII). PMV is an ER aspartic protease that recognizes and cleaves the RXL sequence within the PEXEL motif of proteins exported by human malaria parasite Plasmodium falciparum, allowing them to translocate into host erythrocytes.)
|
- HY-P10457
-
|
15-PGDH (92-105)
|
15-PGDH
|
Others
|
|
5-Hydroxy prostaglandin dehydrogenase blocking peptide (15-PGDH (92-105)) is a blocking peptide that corresponds to the amino acids (AGVNNEKNWEKTLQ) located at positions 92-105 of the 15-hydroxy prostaglandin dehydrogenase (15-PGDH) sequence. 5-Hydroxy prostaglandin dehydrogenase blocking peptide can block the formation of protein-antibody complexes during immunohistochemical analysis of 15-PGDH .
|
- HY-P2496
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
|
|
Endothelin 1 (swine, human), Alexa Fluor 488-labeled is a synthetic Endothelin 1 peptide labled with Alexa Fluor 488. Endothelin 1 (swine, human) is a synthetic peptide with the sequence of human and swine Endothelin 1, which is a potent endogenous vasoconstrictor. Endothelin 1 acts through two types of receptors ETA and ETB .
|
- HY-P11051
-
|
|
Peptides
|
Cancer
|
|
GE11, Cys Conjugated is a peptide conjugate. GE11, Cys Conjugated consists of a GE11 (HY-P10128) conjugated with a GGGGC sequence. GE11, Cys Conjugated can be used for synthesis of stimuli-responsive peptide nanomaterials (SRPNs) for photoacoustic imaging and cancer therapy, such as triple-negative breast cancer (TNBC)
|
- HY-P5499
-
|
|
MHC
|
Others
|
|
CMV pp65(13-27) is a biological active peptide. (This peptide is derived from amino acid residues 13 to 27 of the 65k lower matrix phosphoprotein of the human cytomegalovirus. It contains a nine-amino-acid sequence (LGPISGHVL) that matches the consensus binding motif for a major histocompatibility complex H2-Dd T-cell epitope.)
|
- HY-P3541
-
|
MBP8298
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
Dirucotide (MBP8298) is a synthetic peptide that consists of 17 amino acids linked in a sequence identical to that of a portion of human myelin basic protein. Dirucotide can be used for the research in autoimmune disorder of the central nervous system, such as Multiple sclerosis (MS) .
|
- HY-P3873
-
- HY-P1312A
-
- HY-P5479
-
|
|
Peptides
|
Others
|
|
EE epitope is a biological active peptide. (This peptide is a 314 to 319 amino acids fragment of the middle T antigen of mouse polymavirus. Glu-Glu epitope peptide is widely used as an epitope tag.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5370
-
|
|
Amyloid-β
|
Others
|
|
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
|
- HY-P1310
-
- HY-P1569
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P10458
-
|
Human/rat 5-LO (130-149)
|
Lipoxygenase
|
Others
|
|
5-Lipoxygenase blocking peptide (Human/rat 5-LO 130-149) is a specific sequence fragment of 5-lipoxygenase (5-LOX), which can be utilized to prepare an antibody against 5-LOX .
|
- HY-P11349
-
|
|
Biochemical Assay Reagents
|
Others
|
|
TG-Gln (a glutamine donor peptide with the sequence H-NQEQVSPLERCG-NH₂) is a substrate-type crosslinker targeting activated coagulation transglutaminase XIII (FXIIIa). TG-Gln is promising for research of angiogenesis induction, cartilage repair, and wound healing .
|
- HY-P10176
-
|
|
Opioid Receptor
|
Others
|
|
Acetalin-2 is an opioid peptide with a sequence of Ac-Arg-Phe-Met-Trp-Met-Arg-NH2. Acetalin-2 is selectively bound to [ 3H]DAMGO with a K i value of 93.3 nM .
|
- HY-P2380
-
|
TFRGAP
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
PAR3 (1-6) is a synthetic peptide agonist of proteinase-activated receptor 1 (PAR1) that corresponds to residues 1-6 of the amino terminal tethered ligand sequence of human PAR3 and residues 39-44 of the full-length human sequence. PAR3 (1-6) activates p42/44 MAPK signaling in fibroblasts expressing PAR1, but not PAR3, an effect that can be blocked by the PAR1 antagonist RWJ 56110.
|
- HY-P1230
-
|
|
Dipeptidyl Peptidase
GLP Receptor
|
Metabolic Disease
|
|
HAEGT is the first N-terminal 1-5 residues of glucagon like peptide-1 (GLP-1) peptide, and the sequence is His-Ala-Glu-Gly-Thr. HAEGT acts as a competitive substrate for probing prime substrate binding sites of human dipeptidyl peptidase-IV (DPP-IV) 1, in which the N-terminal His-Ala is catalyzed cleavage by DPP-IV. HAEGT can be used in the research of diabetes, obesity .
|
- HY-P1798
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Platelet Factor 4 (58-70), human, a peptide based on the amino acid sequence corresponding to residues 58-70 of platelet factor-4 (PF-4), contains the major heparin-binding domain, which is not sufficient for full antiangiogenic activity .
|
- HY-P10894
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
mUNO is a tumor-homing peptide (mUNO, sequence: "CSPGAK") that specifically binds to mouse CD206, targeting tumor-associated macrophages that express CD206/MRC1. mUNO can interact with human recombinant CD206 .
|
- HY-P1569A
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P3509A
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-28 acetate is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 acetate can be used for pancreatic cancer research .
|
- HY-P10101
-
|
APTscr
|
STAT
|
Others
|
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
- HY-P3509
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-28 is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 can be used for pancreatic cancer research .
|
- HY-P1310A
-
- HY-P1371
-
|
KKWKMRRNQFWIKIQRC CSVEIWD*
|
PKC
|
Others
|
|
Pseudo RACK1, a peptide, is a PKC agonist with homologous sequences of PKC. Pseudo RACK1 interacts selectively with β-PKC at an autoregulatory site (RACK-binding site) and activates it in the absence of PKC activators, following inducing PKC-mediated histone phosphorylation .
|
- HY-P10496
-
|
|
Peptides
|
Cancer
|
|
MAGE-A1-derived peptide is a short peptide sequence derived from MAGE-A1 protein. As a tumor-specific antigen, MAGE-A1-derived peptide can be recognized and activated by cytotoxic T lymphocytes (CTLs), thereby generating an immune response to tumor cells expressing MAGE-A1. This immune response can lead to the lysis and death of tumor cells. MAGE-A1-derived peptide can be used in the study of tumor immunity .
|
- HY-P10496A
-
|
|
Peptides
|
Cancer
|
|
MAGE-A1-derived peptide acetate is a short peptide sequence derived from MAGE-A1 protein. As a tumor-specific antigen, MAGE-A1-derived peptide acetate can be recognized and activated by cytotoxic T lymphocytes (CTLs), thereby generating an immune response to tumor cells expressing MAGE-A1. This immune response can lead to the lysis and death of tumor cells. MAGE-A1-derived peptide acetate can be used in the study of tumor immunity .
|
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
- HY-P10544
-
|
|
Interleukin Related
|
Others
|
|
Humanized anti-tac (HAT) binding peptide is a peptide that can specifically bind to the Fc region of HAT. HAT is a humanized monoclonal antibody against the low affinity p55 subunit of the interleukin IL-2 receptor. Humanized anti-tac (HAT) binding peptide can be used to develop affinity chromatography media to purify specific monoclonal antibodies .
|
- HY-120833
-
|
|
Caspase
|
Others
|
|
Ac-Ile-Glu-Thr-Asp-pNA is a substrate for caspase-8. Caspase-8 binds to and cleaves the Ile-Glu-Thr-Asp (IETD) peptide sequence to release p-nitroalinide, which can be quantified by colorimetric detection at 405 nm as a measure of enzyme activity .
|
- HY-P1610
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Asudemotide (S-588410) is a peptide of human DEP domain-containing protein 1A. Asudemotide is an immunostimulant. Asudemotide has a sequence of H-Glu-Tyr-Tyr-Glu-Leu-Phe-Val-Asn-Ile-OH. Asudemotide induces a tumor immune response in esophageal cancer. .
|
- HY-P10251
-
|
|
HIV
|
Infection
|
|
HIV gp120 (318-327) is a short sequence of the HIV-1 strain IIIB envelope peptide (rgpgrafvti) that corresponds to the conserved C-terminal region of the glycoprotein. HIV gp120 (318-327) is part of the HIV vaccine V3 peptide epitope, also known as the I10 peptide. However, HIV gp120 (318-327) lacks the A2 anchor residues recognized by epitope-specific CTLs but has structural features that confer promiscuous A2 binding .
|
- HY-P3605
-
|
GAP (25-53), human
|
GnRH Receptor
|
Endocrinology
|
|
GnRH Associated Peptide (GAP) (25-53), human is the human gonadotropin-releasing hormone-associated peptide (GAP) 25-53 fragment (hGAP-25-53), can be used as immunogen to generate antiseras including MC-1, MC-2, and MC-3. GAP is joined to the luteinizing hormone-releasing hormone (LH-RH) sequence by a 3 amino acid processing site .
|
- HY-P2019
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Levitide is a neurohormone-like peptide, can be isolated from skin secretions of the South African frog Xenopus laevis. Levitide comes from preprolevitide, is 88 residues long and contains contains the levitide peptide at the C terminus (Glu-Gly-Met-Ile-Gly-Thr-Leu-Thr-Ser-Lys-Arg-Ile-Lys-Gln-NH2) and the putative signal sequence at the N terminus .
|
- HY-115379
-
|
|
Peptides
|
Cancer
|
|
Latromotide is a synthetic peptide with antineoplastic activity. It consists of 10 amino acids corresponding to amino acid residues 66-75 of the human kinesin-like protein KIF20A. Latromotide has a sequence of H-Lys-Val-Tyr-Leu-Arg-Val-Arg-Pro Leu-Leu-OH .
|
- HY-P4144
-
|
Phor18-LHRH (338613); EP-100
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Onvitrelin ucalontide ([Phor18-LHRH (338613)]) is an analogue of luteinizing hormone releasing hormone (LHRH) with antineoplastic activity. Onvitrelin ucalontide is a peptide with sequences of KFAKFAKKFAKFAKKFAKQHWSYGLRPG. Onvitrelin ucalontide effectively inhibits breast cancer, ovarian cancer and prostate cancer xenografts in mouse model .
|
- HY-P0323
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
- HY-P5439
-
|
|
PKC
MARCKS
|
Others
|
|
Epsilon-V1-2, Cys-conjugated is a biological active peptide. (This peptide is the εPKC specific inhibitor. Its inhibitory activity is based on εPKC translocation and MARCKS phosphorylation. This peptide interferes with εPKC interaction with the anchoring protein εRACK. This peptide contains a cysteine residue added to the C-terminus for potential S-S bond formation with a carrier protein.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5429
-
|
|
Peptides
|
Others
|
|
DNA-PK Substrate is a biological active peptide. (A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activityPyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P10790
-
|
|
Microtubule/Tubulin
|
Cancer
|
|
Breast cancer targeting peptide 18–4 is a KRT1 receptor-targeting peptide, with a Kd of 0.98 μM. The amino acid sequence of Breast cancer targeting peptide 18–4 is WxEAAYQrFL, and it is an analogue of P160 peptide (HY-P10789). When covalently conjugated with the anticancer peptide MccJ25, Breast cancer targeting peptide 18–4 significantly increases the cellular uptake of MccJ25 in breast cancer cells and enhances its anticancer activity. The covalent conjugate exhibits IC50 values of 14.2, 20, and 25 μM against MCF-7, MDA-MB-435, and MDA-MB-435-MDR cells, respectively .
|
- HY-P3325
-
|
D-P8RI
|
VEGFR
|
Inflammation/Immunology
|
|
P8RI (D-P8RI) is a biomimetic peptide of CD31 and a CD31 agonist. P8RI binds to the juxtamembrane amino acid sequence of the ectodomain of CD31, shows an immunosuppressive effect through restoration of the CD31 inhibitory pathway .
|
- HY-P11087
-
|
|
Collagen
|
Others
|
|
P15 is a collagen mimetic peptide with the sequence of GTPGPQGIAGQRGVV. P15 can mimic the cell-binding domain of human type I collagen. P15 is capable of promoting the adhesion, proliferation, and differentiation of osteoblasts. Biomaterials modified with P15 can be used in research related to bone regeneration .
|
- HY-P3581
-
|
|
Potassium Channel
|
Neurological Disease
|
|
PE 22-28 is a TREK-1 inhibitor with IC50 value of 0.12 nM. PE 22-28 also is a 7 amino-acid peptide that is used as a core sequence for preparing analogs by chemical modifications and also by substitution of amino-acids. PE 22-28 can be used for the research of depression .
|
- HY-P10786
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
LinTT1 peptide is a tumor-penetrating peptide with the amino acid sequence AKRGARST. LinTT1 peptide targets peritoneal carcinoma (PC) by binding to the p32 (gC1qR) receptor. It can conjugate with iron oxide nanoworms (NWs) to form a nanocarrier. This nanocarrier is taken up by peritoneal carcinoma cells in vitro and enters the mitochondria; it also exhibits significant tumor targeting and penetration effects in mice. Moreover, LinTT1-functionalized nanocarriers, combined with the pro-apoptotic peptide [D(KLAKLAK)2], show significant tumor suppression in a mouse peritoneal tumor model. LinTT1 peptide holds promise as a delivery carrier for peritoneal cancer research .
|
- HY-P10471
-
|
MARCKS-ED
|
MARCKS
PKC
|
Others
|
|
MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
- HY-P1115
-
|
|
Akt
|
Others
|
|
AKTide-2T is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
- HY-P5472
-
|
|
Transmembrane Glycoprotein
|
Others
|
|
Tumour-associated MUC1 epitope is a biological active peptide. (This sequence is the hallmark of MUC1 mucin. MUC1 is a highly glycosylated type I transmembrane glycoprotein with a unique extracellular domain consisting of a variable number of tandem repeats (VNTR) of this 20 amino acid peptide. It is overexpressed on the cell surface of many human adenocarcinomas and hematological malignancies, including multiple myeloma and B-cell lymphoma, making MUC1 broadly applicable target for immunotherapeutic strategies.)
|
- HY-P10295
-
|
|
MDM-2/p53
|
Cancer
|
|
p53 (232-240) is a peptide segment of the 232-240 amino acid sequence of the human tumor suppressor protein p53. p53 (232-240) enhances its binding affinity to the Major histocompatibility complex (MHC), thereby enhancing the immunogenicity of this peptide to enhance the immune system's response to tumor antigens. p53 (232-240) can be used in the development of cancer vaccines and in the study of tumor cell recognition and clearance by the immune system .
|
- HY-P10055
-
|
PSMA-1
|
PSMA
|
Cancer
|
|
PSMA-1 is a PSMA targeting peptide (GRFLTGGTGRLLRIS) and can be used for for targeted delivery of glucose-regulated protein (GRP)-silencing siRNAs in PCa cells. PSMA-1 is selected and polyarginine sequences R6 or R9 were added at the C terminus to generate the CTPs. FITC labeling of the peptide with an aminohexanoic acid (Ahx) linker at the N terminus produced FITC-PSMA-1,to track PSMA binding on PCa cells .
|
- HY-P11219
-
|
|
YAP
|
Cancer
|
|
TAT-PDHPS1 is a YAP inhibitor composed of the endogenous peptide PDHPS1 and the cell-penetrating peptide sequence TAT. PDHPS1 binds to protein phosphatase 2 phosphatase activator (PTPA), an essential activator of protein phosphatase 2A (PP2A), leading to increased YAP phosphorylation, which inactivates YAP and suppresses the expression of its downstream target genes. TAT-PDHPS1 is potentially useful in ovarian cancer research .
|
- HY-P4307
-
|
|
SARS-CoV
|
Infection
|
|
Antioxidant agent-9 is a peptide with the sequence Asp-Trp. Antioxidant agent-9 shows antioxidant activity. Antioxidant agent-9 also is potential as SARS-CoV-2 antiviral, with an affinity strength equal to Chloroquine (HY-17589A) and Favipiravir (HY-14768) .
|
- HY-P10388
-
|
|
CD47
TGF-β Receptor
|
Cancer
|
|
TAX2 peptide is a dodecapeptide based on molecular docking and simulation design, derived from the cell surface receptor CD47 sequence. TAX2 peptide acts as a selective antagonist of TSP-1 (thromboxin-1) interacting with CD47. TAX2 peptide can promote the binding of TSP-1 to CD36, which leads to the destruction of VEGFR2 (vascular endothelial growth factor receptor 2) activation, thereby blocking downstream NO (nitric oxide) signaling, demonstrating anti-angiogenic properties. TAX2 peptide can be used to study angiogenesis and tumor cell interactions in the tumor microenvironment .
|
- HY-P10601
-
- HY-P10601A
-
- HY-P1115A
-
|
|
Akt
|
Others
|
|
AKTide-2T TFA is an excellent in vitro substrate for AKT and shows competitive inhibition of histone H2B phosphorylation with a Ki of 12 nM. AKTide-2T TFA mimics the optimal phosphorylation sequence of Akt and is an inhibitory peptide with the wildtype AKTide lacking Thr in the S22 position .
|
- HY-P10794
-
|
|
Peptides
|
Cancer
|
|
LH2 peptide is a pH-responsive cell-penetrating peptide dimer with the amino acid sequence LHHLCHLLHHLCHLAG. It can increase its uptake in tumor cells under weakly acidic conditions (such as the tumor microenvironment) through the protonation of histidine residues (pKa approximately 6). When conjugated with the anticancer drug Paclitaxel (HY-B0015), the PTX-LH2 conjugate showed superior tumor suppression effects compared to paclitaxel alone in a subcutaneous breast tumor model. The LH2 peptide holds potential as a drug delivery vehicle in cancer research .
|
- HY-P10792
-
|
|
EGFR
|
Cancer
|
|
HER2-targeted peptide H6F is a HER2 targeting peptide that binds to HER2 to target breast cancer cells, with the amino acid sequence YLFFVFER. The HER2-targeted peptide H6F can be conjugated with the bifunctional chelating agent hydrazinonicotinamide (HYNIC) for radiolabeling with 99mTc. Single-photon emission computed tomography (SPECT) imaging shows that the labeled HER2-targeted peptide H6F specifically accumulates in HER2-positive MDA-MBA-453 tumor-bearing mice models. The HER2-targeted peptide H6F can be used for tumor molecular imaging studies .
|
- HY-P11204
-
|
|
Peptide-Drug Conjugates (PDCs)
|
Others
|
|
DDDEEKC is a bioinspired peptide sequence that can selectively adsorb onto the enamel surface (mimicking the role of salivary acquired pellicle protein statherin), acting as a "target - guiding agent" for tooth enamel remineralization. DDDEEKC enhances the regeneration of hydroxyapatite (HAP). DDDEEKC is promising for research of in-situ remineralization repair of enamel demineralization damage (such as dental caries) .
|
- HY-P0323A
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41) TFA, a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus. GP(33-41) TFA can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
- HY-P5471
-
|
[Leu27]-Melan-A, MART-1 (26-35)
|
Peptides
|
Others
|
|
Melan-A/MART-1 analog ([Leu27]-Melan-A, MART-1 (26-35)) is a biological active peptide. (This Melan-A (26-35) analog, Leu substituted for Ala at position 27, shows better HLA-A*0201 binding properties as well as better immunogenicity and antigenicity than the natural Melan-A (26-35).Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P10405
-
|
|
Dopamine Receptor
|
Neurological Disease
|
|
TAT-D1 peptide is a selective D1-D2 heterogeneous antagonist. TAT-D1 peptide destroys the heterodimer of the D1-D2 receptor by interacting with the specific domain of the D2 receptor through its unique amino acid sequence, in particular the two glutamate residues at the C terminal of the D1 receptor. TAT-D1 peptide can be used to study the role of D1-D2 receptor heterodimers in the regulation of depressive and anxiety-like behaviors .
|
- HY-P5461
-
|
|
Bacterial
|
Others
|
|
CHRG01 is a biological active peptide. (CHRG01 is derived from human b-defensin 3 (hBD3) C-terminal amino acids 54 to 67, with all Cys residues substituted with Ser. This substitution removes all disulfide bond linkages within the sequence. CHRG01, like hBD3, displays electrostatic-dependent antimicrobial properties.)
|
- HY-P10702
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p1 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10703) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p1 is promising for the development of nanomaterials in the biomedical field .
|
- HY-P10703
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p2 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10702) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p2 is promising for the development of nanomaterials in the biomedical field .
|
- HY-P10661
-
|
|
Biochemical Assay Reagents
|
Others
|
|
L-KYFIL is a pentapeptide that is amorphous on its own. When mixed with D-KYFIL, it transforms from fibrous hydrogels into plate-like networks, resulting in changes in mechanical properties and forming a crystalline state. The mixture can protect L-KYFIL from proteolytic degradation. L-KYFIL can be used to study stereocomplexation behavior of peptide sequences and in the development of biomaterials .
|
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5325A
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) (acetate) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P4873
-
|
|
Amylin Receptor
|
Neurological Disease
|
|
Amylin (20-29) (human) is the fragment of human islet amyloid polypeptide (hIAPP) or Amylin. Amylin is a 37-residue hormone. Amylin (20-29) (human) is responsible for the amyloidogenic propensities of the full length protein. Amylin (20-29) (human) can be transformed into its corresponding peptoid and retropeptoid sequences, to obtain beta-sheet breaker peptides as amyloid inhibitors .
|
- HY-P10491
-
|
|
Peptides
|
Cancer
|
|
MAGE A4 (230-239) is a peptide sequence derived from the MAGE-A4 protein. MAGE A4 (230-239) is an immunogenic epitope that can activate T cells and trigger the killing of tumor cells expressing MAGE-A4. MAGE A4 (230-239) is used in the development of next-generation T cell-based immunotherapies .
|
- HY-P10471A
-
|
MARCKS-ED TFA
|
MARCKS
PKC
|
Others
|
|
MPSD TFA (MARCKS-ED TFA) is the TFA salt form of MPSD (HY-P10471). MPSD TFA is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD TFA can sense membrane curvature and recognize phosphatidylserine. MPSD TFA can be utilized as biological probe to study membrane shape and lipid composition .
|
- HY-P3726
-
|
|
Integrin
|
Inflammation/Immunology
Cancer
|
|
Lys-Gln-Ala-Gly-Asp-Val (KQAGDV) is the six most carboxyl-terminal amino acids in the fibrinogen γ-chain sequence. Lys-Gln-Ala-Gly-Asp-Val is a cell adhesion peptide which is mediated through the α2bβ3 integrin. Lys-Gln-Ala-Gly-Asp-Val is a potent adhesion ligand for smooth muscle cells (SMCs) .
|
- HY-P1906
-
|
|
CDK
|
Neurological Disease
|
|
[pThr3]-CDK5 Substrate is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
- HY-P1906A
-
|
|
CDK
|
Neurological Disease
|
|
[pThr3]-CDK5 Substrate TFA is an effective Phospho-Thr3CDK5 Substrate. [pThr3]-CDK5 Substrate is derived from the sequence of the histone H1 peptide that docks in the active site of CDK5. [pThr3]-CDK5 Substrate is phosphorylated by CDK5 with a Km value of 6 µM .
|
- HY-P2507
-
|
|
Peptides
|
Cancer
|
|
NY-ESO-1 (87-111) is a pan-MHC class II-restricted peptide sequence. NY-ESO-1 (87-111) binds to multiple HLA-DR and HLA-DP4 molecules, and stimulates Th1-type and Th-2/Th0-type CD4 + T cells when presented in the context of HLA-DR and HLA-DP4 molecules .
|
- HY-P5485
-
|
|
Bacterial
|
Others
|
|
Dabcyl-QALPETGEE-Edans is a synthetic peptide substrate for fluorescence resonance energy transfer (FRET) detection of Sortase A (SrtA) enzymatic activity. Dabcyl-QALPETGEE-Edans is labeled at both ends with the fluorescent group Edans (donor) and the quencher Dabcyl (acceptor), respectively. Dabcyl-QALPETGEE-Edans's central sequence contains a conserved motif specifically recognized by SrtA. Dabcyl-QALPETGEE-Edans demonstrates high sensitivity in vitro assays, enabling precise determination of the half-maximal inhibitory concentration of SrtA .
|
- HY-P10417
-
|
|
Integrin
|
Others
Cancer
|
|
RTDLDSLRTYTL is an Alpha (v) beta (6) integrin (avb6) inhibitor with high affinity and specificity. RTDLDSLRTYTL binds to avb6 integrin, a peptide sequence that activates cytotoxicity and cytokine production in T cells, such as interferon-gamma. RTDLDSLRTYTL is designed through a chimeric T cell antigen receptor (CAR) so that T cells can be redirected to specifically recognize and attack tumor cells. RTDLDSLRTYTL can be used in the research of cancer immunotherapy and targeted drug development .
|
- HY-P11208
-
|
|
GABA Receptor
|
Inflammation/Immunology
|
|
mNLS-CPP-WSTF is a nuclear localization signal (NLS)-cell-penetrating peptide based on the mouse WSTF sequence. mNLS-CPP-WSTF significantly inhibits the GABARAP-WSTF interaction, WSTF degradation and inflammatory gene expression. mNLS-CPP-WSTF effectively attenuates chronic inflammation, liver fibrosis and cartilage damage in metabolic-dysfunction-associated steatohepatitis (MASH) and osteoarthritis (OA) mice model. mNLS-CPP-WSTF is promising for research of chronic inflammatory diseases such as MASH and OA .
|
- HY-P10553
-
|
|
Apoptosis
|
Cancer
|
|
ARF(26–44), cell-permeable is a cell-penetrating peptide derived from a specific amino acid sequence of the p14ARF tumor suppressor protein. As a functional inhibitor of FoxM1, ARF(26–44) cell-permeable shows significant anti-tumor activity in the treatment of mouse hepatocellular carcinoma (HCC), significantly increasing tumor cell apoptosis and reducing tumor cell proliferation and angiogenesis. ARF(26–44), cell-permeable can be used in research on tumor therapy .
|
- HY-P2307
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P2307A
-
|
|
iGluR
NO Synthase
|
Neurological Disease
|
|
Tat-NR2BAA TFA is the control peptide of Tat-NR2B9c (HY-P0117), inactive. The sequence of Tat-NR2BAA TFA is similar to Tat-NR2B9c, but it has a double-point mutation in the COOH terminal tSXV motif, making it incapable of binding PSD-95. Tat-NR2B9c is a membrane-permeant peptide and disrupts PSD-95/NMDAR binding, correlate with uncoupling NR2B- and/or NR2A-type NMDARs from PSD-95 .
|
- HY-P11208C
-
|
|
GABA Receptor
|
Inflammation/Immunology
|
|
mNLS-CPP-WSTF TFA is the trifluoroacetate salt of mNLS-CPP-WSTF (HY-P11208). mNLS-CPP-WSTF is a nuclear localization signal (NLS)-cell-penetrating peptide based on the mouse WSTF sequence. mNLS-CPP-WSTF significantly inhibits the GABARAP-WSTF interaction, WSTF degradation and inflammatory gene expression. mNLS-CPP-WSTF effectively attenuates chronic inflammation, liver fibrosis and cartilage damage in metabolic-dysfunction-associated steatohepatitis (MASH) and osteoarthritis (OA) mice model. mNLS-CPP-WSTF is promising for research of chronic inflammatory diseases such as MASH and OA .
|
- HY-P5558
-
|
|
VEGFR
|
Neurological Disease
|
|
KLTWQELYQLKYKGI is a VEGF mimetic peptide designed based on the VEGF helix sequence 17-25, with the ability to activate VEGF receptors and exert pro-angiogenic biological activity. KLTWQELYQLKYKGI effectively promotes the attachment, spreading and proliferation of human umbilical vein endothelial cells. KLTWQELYQLKYKGI enhances the proliferation, migration and osteogenic differentiation of bone marrow stromal cells (BMSCs). KLTWQELYQLKYKGI synergistically accelerates angiogenesis and bone regeneration in rat cranial defect models. KLTWQELYQLKYKGI can be used for the research of brain tissue engineering and traumatic brain injury repair and biomaterials for bone tissue engineering and bone repair .
|
- HY-P10464
-
|
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
|
TAT-AKAP79 326-336 is a cytoosmotic peptide. TAT-AKAP79 326-336 mimics a specific region on the AKAP79 protein that binds to TRPV1 ion channels (amino acid sequence 326-336). TAT-AKAP79 326-336 inhibits the sensitization of TRPV1 and reduce the overresponse of TRPV1 channels to stimuli caused by the activation of cellular kinases such as protein kinase A (PKA) and protein kinase C (PKC) by inflammatory mediators. TAT-AKAP79 326-336 can be used to study the mechanism of pain transduction and inflammatory hyperalgesia .
|
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P99591
-
|
AS1402; huHMFG-1
|
Mucin
|
Cancer
|
|
Sontuzumab (AS1402) is a humanizedised IgG1κ MUC1 specific monoclonal antibody. Sontuzumab binds the extracellular MUC1 peptide sequence PDTR with a Kd of ~1 nM. Sontuzumab can be used for the research of breast cancer .
|
-
- HY-P991158
-
|
|
TGF-β Receptor
|
Neurological Disease
|
|
Rinvatercept, a fusion protein, is a glycyl (1)-chimeric N-terminal (1-108)-peptide (2-109) combined from the sequences of the extracellular domains of the human ACVR2A/B, and is fused via a G3 peptide linker (110-112) to an immunoglobulin G1 (IgG1) Fc fragment. Rinvatercept can be used for research of neuromuscular disease .
|
-
- HY-P990088
-
|
|
VEGFR
PD-1/PD-L1
|
Cardiovascular Disease
|
|
Sotiburafusp alfa is a bispecific fusion protein, which is a humanized VEGFR-1 extracellular domain fragment (129-228, 1-100 in the current sequence) fused via the peptide linker 101GGSGGSGGSGGSGGS 115 to the N-terminus of the heavy chain (116-564) of a humanized IgG1-kappa anti-human PD-L1 heavy chain variant L352>A, L353>A. Sotiburafusp alfa is also an angiogenesis inhibitor .
|
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
| Cat. No. |
Product Name |
|
Classification |
-
- HY-112295
-
|
|
|
Azide
|
|
AzKTB is a capture reagent which bears a short trypsin-cleavable peptide sequence between the azide module and the TAMRA/PEG-biotin labels. AzKTB is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.
|
-
- HY-151678
-
|
|
|
Azide
|
|
N3-L-Lys(Mtt)-OH is a click chemistry reagent containing an azide group. N3-L-Lys(Mtt)-OH can introduce azide functions into the amino acid building block of peptide sequences at the N-terminal position. It contains an azide group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing alkyne groups. It can also undergo ring strain-promoted alkyne-azide cycloaddition (SPAAC) with molecules containing DBCO or BCN groups.
|
-
- HY-151780
-
|
|
|
Alkynes
|
|
Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent containing an azide group. Fmoc-L-Dap(Pentynoyl)-OH serves as an amino acid building block for introducing alkyne functions into peptide sequences by standard Fmoc/tBu protocols. The alkyne residue can be engaged for copper catalyzed click reaction with organic azides or with tetrazines for copper-free conjugations . Fmoc-L-Dap(Pentynoyl)-OH is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
| Cat. No. |
Product Name |
|
Classification |
-
- HY-172714
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG2000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172713
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG1000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172715
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG5000-MPG is a PEG compound which composed of DSPE and a peptide vector (MPG). MPG is derived from both the nuclear localisation sequence (NLS) of SV40 large T antigen and the fusion peptide domain of HIV-1 gp41. MPG could deliver short oligonucleotides into cells efficiently and independently of the endosomal pathway .
|
-
- HY-172283A
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG2000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG1000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
-
- HY-172283B
-
|
|
|
Pegylated Lipids
|
|
DSPE-PEG5000-BR2 is a PEG compound which composed of DSPE and a BR2. BR2 is a targeting peptide composed of 17 amino acids with the sequence RAGLQFPVGRLLRRLLR. It has the ability to assist cells to penetrate the membrane and can specifically target certain cells or tissues .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: