1. Search Result
Search Result
Results for "

peptide sequence

" in MedChemExpress (MCE) Product Catalog:

166

Inhibitors & Agonists

2

Fluorescent Dye

9

Biochemical Assay Reagents

196

Peptides

3

Inhibitory Antibodies

1

Natural
Products

3

Click Chemistry

6

Oligonucleotides

Cat. No. Product Name Target Research Area
  • HY-P3460A
    TDSRCVIGLYHPPLQVY TFA
    1 Publications Verification

    Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY TFA is a disordered control peptide. TDSRCVIGLYHPPLQVY TFA is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P3051

    Reverse Transcriptase Inflammation/Immunology
    CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
  • HY-P5217

    Peptides Others
    CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
  • HY-P3287

    Peptides Others
    UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .
  • HY-P3460

    Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P10116

    APTscr-9R

    STAT Others
    APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
  • HY-P1138

    FSVYWAQADR

    Gap Junction Protein Others
    Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
  • HY-P2665

    Peptides Others
    Lymphocyte activating pentapeptide is a short peptide sequence found in the Fc region of human IgG1 that has the ability to activate lymphocytes. Lymphocyte activating pentapeptide can be used to study the activation mechanisms of B cells and T cells, and their role in immune responses .
  • HY-P10593

    Transmembrane Glycoprotein Influenza Virus Cancer
    Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
  • HY-P3956

    Peptides Others
    Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide .
  • HY-P11088

    Transmembrane Glycoprotein Others
    VCAM1 binding peptide is a peptide that can bind to VCAM1, with the sequence of VHPKQHRGGSKGC .
  • HY-P5394

    Peptides Others
    Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
  • HY-P0329

    Peptides Others
    X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.
  • HY-P4132

    Peptides Cancer
    Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .
  • HY-P1965

    Peptides Cancer
    Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
  • HY-P1963

    Peptides Cancer
    Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.
  • HY-P1964

    Peptides Cancer
    Ac-IEVDIDVE TFA is a short peptide sequence with Ac at the end.
  • HY-P1966

    Peptides Cancer
    Ac-IEVDID TFA is a short peptide sequence with Ac at the end.
  • HY-P1967

    Peptides Cancer
    Ac-VDID TFA is a short peptide sequence with Ac at the end.
  • HY-P4093

    Amino Acid Derivatives Others
    Cys-Penetratin is a cell-penetrating peptide (CPP) with sequence of CRQIKIWFQNRRMKWKK .
  • HY-P10190

    Peptides Others
    CADY is a cell-penetrating peptide (CPPs) peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .
  • HY-P10156

    Cell-penetrating peptide MAP17

    Peptides Others
    MAP17 (Cell-penetrating peptide MAP17) is a synthetic secondary amphipathic cell-penetrating peptides, with sequence of QLALQLALQALQAALQLA .
  • HY-P2361
    S12

    Ras Others
    S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .
  • HY-P2193

    Peptides Infection
    TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-P1908

    NADPH Oxidase Cardiovascular Disease Cancer
    sgp91 ds-tat Peptide 2, scrambled is a scrambled sequence of NADPH oxidase inhibitor gp91 ds-tat peptide .
  • HY-P2641

    MMP Cancer
    Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
  • HY-P5119

    Peptides Neurological Disease
    Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
  • HY-P5119A

    Peptides Neurological Disease
    Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
  • HY-P2193A

    Peptides Infection
    TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-P3526

    Biochemical Assay Reagents Others
    YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability
  • HY-P3818

    PKC Others
    PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
  • HY-P1870

    Peptides Inflammation/Immunology
    OVA sequence (323-336) is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogenicity.
  • HY-P1517

    Amyloid-β Neurological Disease
    β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.
  • HY-P4872

    Peptides Neurological Disease
    Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP .
  • HY-P5118

    Peptides Neurological Disease
    Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
  • HY-P10187

    Peptides Others
    α-Casein (90-96) is a peptide with sequence of Arg-Tyr-Leu-Gly-Tyr-Leu-Glu .
  • HY-P10158

    Porcine cathelicidin PMAP-36

    Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
  • HY-P1311

    Drug Isomer Others
    RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
  • HY-P0315
    Crosstide
    2 Publications Verification

    Akt Others
    Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
  • HY-P1734

    PKC Neurological Disease
    Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .
  • HY-P11355

    Peptides Cancer
    KRAS WT Peptide is the normal sequence peptide of the Kirsten rat sarcoma virus (KRAS) gene without oncogenic mutations. KRAS WT Peptide can be used for the study of evaluating the specificity and safety of KRAS-targeted immunotherapies .
  • HY-P5353

    IKVAV sequence; Laminin A-chain fragment

    Peptides Others
    PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)
  • HY-P10787

    Complement System Cancer
    tLyP-1 peptide is an NRP-1 targeting peptide with an IC50 of 4 μM, and its amino acid sequence is CGNKRTR. tLyP-1 peptide specifically binds to NRP-1 to target tumor cells .
  • HY-P10651

    Biochemical Assay Reagents Others
    Lifeact peptide is a 17-amino-acid sequence derived from an actin-binding domain of yeasts. Lifeact peptide can specifically bind to actin microfilaments and can be used for the labeling of actin .
  • HY-P10020

    hTERT (660–689)

    Peptides Cancer
    Alrefimotide is a hTERT-derived immunogenic peptide. Alrefimotide has a sequence of ALFSVLNYERARRPGLLGASVLGLDDIHRA. Alrefimotide can be used in cancer immunotherapy research .
  • HY-P4054

    Peptides Others
    IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering
  • HY-P4425

    Biochemical Assay Reagents Others
    Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .
  • HY-P5118A

    Peptides Neurological Disease
    Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
  • HY-P10778

    Amino Acid Derivatives Neurological Disease
    me4 Peptide is a synthetic peptide designed based on the microexon me4 sequence of neuronal CPEB4 protein. me4 Peptide inhibits CPEB4 aggregation. me4 Peptide can be used in the study of disorders associated with autism spectrum disorders .
  • HY-P10709

    Biochemical Assay Reagents Cardiovascular Disease Cancer
    CREKA peptide is a short peptide sequence, belonging to self-assembling peptides (SAPs), which can self-assemble into functional nanostructures, typically nanofibers, under physiological conditions. CREKA peptide can be used to target tumor cells and tumor vasculature, exhibiting antitumor activity .

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: