2. Search Result
Search Result
Results for "

peptide sequence

" in MedChemExpress (MCE) Product Catalog:

79

Inhibitors & Agonists

1

Fluorescent Dye

160

Peptides

2

Inhibitory Antibodies

1

Natural
Products

3

Click Chemistry

Cat. No. Product Name Target Research Area
  • HY-P3460A
    TDSRCVIGLYHPPLQVY TFA

    		Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY TFA is a disordered control peptide. TDSRCVIGLYHPPLQVY TFA is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P3287
    UL75 (14-42)，Human herpesvirus 5

    		Peptides Others
    UL75 (14-42), Human herpesvirus 5, as a peptide, is a sequence of human herpesvirus 5 .
  • HY-P3460
    TDSRCVIGLYHPPLQVY

    		Peptides Cardiovascular Disease Neurological Disease Inflammation/Immunology
    TDSRCVIGLYHPPLQVY is a disordered control peptide. TDSRCVIGLYHPPLQVY is a peptide containing the same amino acids as LP17 (HY-P3400) but in a different sequence order .
  • HY-P10116
    APTSTAT3-9R, scrambled

    APTscr-9R

    		 Peptides Others
    APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
  • HY-P1138
    Scrambled 10Panx

    FSVYWAQADR

    		 Peptides Others
    Scrambled 10Panx (FSVYWAQADR) is a random sequence variant of a specific inhibitory peptide 10Panx targeted at the half-channel of Pannexin-1 (Panx1). Scrambled 10Panx is used as a control peptide to determine whether other experimental conditions or peptides act through specific molecular mechanisms. Scrambled 10Panx can be used for research in neurobiology and cell biology .
  • HY-P2665
    Lymphocyte activating pentapeptide

    		Peptides Others
    Lymphocyte activating pentapeptide is a short peptide sequence found in the Fc region of human IgG1 that has the ability to activate lymphocytes. Lymphocyte activating pentapeptide can be used to study the activation mechanisms of B cells and T cells, and their role in immune responses .
  • HY-P3051
    CKS-17

    		Peptides Inflammation/Immunology
    CKS-17 is a synthetic retroviral envelope peptide. CKS-17 has the highly conserved amino acid sequences occurring within the transmembrane envelope protein of many animal and human retroviruses. CKS-17 acts as an immunomodulatory epitope and exhibits suppressive properties for numerous immune functions .
  • HY-P10593
    Influenza A NP (383-391) (HLA-B27)

    		Peptides Cancer
    Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
  • HY-P5217
    CSTSMLKAC (disulfide)

    		Peptides Others
    CSTSMLKAC (peptide 2) is a cyclic 9 amino acid sequence that mimics endogenous peptide sequences. CSTSMLKAC homes to cardiomyocytes in the ischemic myocardium .
  • HY-P3956
    Prosomatostatin (1-32), porcine

    		Peptides Others
    Prosomatostatin (1-32), porcine is a peptide with sequences overlapping, but not identical to, the neuronostatin peptide .
  • HY-P5394
    Dby HY Peptide (608-622), mouse

    		Peptides Others
    Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
  • HY-P0329
    X-press Tag Peptide

    		Peptides Others
    X-press Tag Peptide is a tag peptide used for protein purification. X-press Tag is also an N-terminal leader peptide; this N-terminal peptide contains a polyhistidine sequence, the Xpress epitope (part of bacteriophage T7 gene 10 protein) and an enterokinase cleavage site. Anti-Xpress antibodies recognize the Xpress epitope sequence found in this leader peptide.
  • HY-P4132
    Membrane-Permeable Sequence, MPS

    		Peptides Cancer
    Membrane-Permeable Sequence, MPS is a cell-penetrating peptide (CPP). Membrane-Permeable Sequence, MPS can be used for the research of membrane crossing mechanism .
  • HY-P1963
    Ac-IEVDIDVEH TFA

    		Peptides Cancer
    Ac-IEVDIDVEH TFA is a short peptide sequence with Ac at the end.
  • HY-P1964
    Ac-IEVDIDVE TFA

    		Peptides Cancer
    Ac-IEVDIDVE TFA is a short peptide sequence with Ac at the end.
  • HY-P1965
    Ac-IEVDIDV TFA

    		Peptides Cancer
    Ac-IEVDIDV TFA is a short peptide sequence with Ac at the end.
  • HY-P1966
    Ac-IEVDID TFA

    		Peptides Cancer
    Ac-IEVDID TFA is a short peptide sequence with Ac at the end.
  • HY-P1967
    Ac-VDID TFA

    		Peptides Cancer
    Ac-VDID TFA is a short peptide sequence with Ac at the end.
  • HY-P4093
    Cys-Penetratin

    		Amino Acid Derivatives Others
    Cys-Penetratin is a cell-penetrating peptide (CPP) with sequence of CRQIKIWFQNRRMKWKK .
  • HY-P2361
    S12

    		Peptides Others
    S12 is a mutant RAS peptide containing the Gly (G) to Ser (S12) substitution. The sequence of the peptide is KLVVVGASGVGKS .
  • HY-P10156
    MAP17

    Cell-penetrating peptide MAP17

    		 Peptides Others
    MAP17 (Cell-penetrating peptide MAP17) is a synthetic secondary amphipathic cell-penetrating peptides, with sequence of QLALQLALQALQAALQLA .
  • HY-P10190
    CADY

    		Peptides Others
    CADY is a cell-penetrating peptide (CPPs) peptide with a sequence of GLWRALWRLLRSLWRLLWRA. CADY can be used as a vector tool for intracellular delivery .
  • HY-P10510
    R5 peptide

    		Peptides Others
    R5 peptide is one of the repeating peptide sequences that form the protein diatom in Cylindrotheca fusiformis. R5 peptide can be used as a template for the synthesis of Pd (palladium) nanoparticles (NPs). R5 peptide forms complexes with metal ions through the amine groups in its sequence, and the self-assembled structure of the peptide provides a confined spatial environment for the reduction of metal ions and the nucleation of nanoparticles. R5 peptide can be used in the research of biomimetic nanomaterials .
  • HY-P2193
    TAT-amide

    		Peptides Infection
    TAT-amide is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-P2480
    Histone H1-derived Peptide

    		Peptides Others
    Histone H1-derived Peptide is a phosphopeptide and the peptide substrates containes a sequence in accordance with the optimal recognition motif for CDKs .
  • HY-P1908
    sgp91 ds-tat Peptide 2, scrambled

    		Peptides Cardiovascular Disease Cancer
    sgp91 ds-tat Peptide 2, scrambled is a scrambled sequence of NADPH oxidase inhibitor gp91 ds-tat peptide .
  • HY-P2641
    Peptide 74

    		MMP Cancer
    Peptide 74 is a synthetic peptide containing the prodomain sequence of matrix metalloproteinase (MMP). Peptide 74 inhibits the activated form of the 72-kDa type IV collagenase in vitro .
  • HY-P3526
    YQEAFRRFFGPV

    		Peptides Others
    YQEAFRRFFGPV is a short peptide sequence containing 12 amino acid residues with some emulsification ability
  • HY-P5119
    Tat-peptide control 168-189

    		Peptides Neurological Disease
    Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
  • HY-P5119A
    Tat-peptide control 168-189 TFA

    		Peptides Neurological Disease
    Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
  • HY-P2193A
    TAT-amide TFA

    		Peptides Infection
    TAT-amide TFA is a cell penetrating peptide. Cell-penetrating peptides (CPPs) are short amino acid sequences able to enter different cells .
  • HY-P3818
    PKCδ Peptide Substrate

    		PKC Others
    PKCδ Peptide Substrate is an absolutely specific substrate for the δ-type of PKC, with a sequence corresponding to sequence 422-443 of murine eEF-1α and containing Thr-431 .
  • HY-P1517
    β-Amyloid (31-35)

    		Amyloid-β Neurological Disease
    β-Amyloid (31-35) is the shortest sequence of native Amyloid-β peptide that retains neurotoxic activity.
  • HY-P1870
    OVA sequence (323-336)

    		Peptides Inflammation/Immunology
    OVA sequence (323-336) is a cognate helper T-lymphocyte peptide that is employed to enhance CTL epitope immunogenicity.
  • HY-P4872
    Alarin (human)

    		Peptides Neurological Disease
    Alarin (human) is a hypothalamic neuropeptide belonging to the galanin family of peptides. Alarin (human) has the signal sequence of the GALP precursor peptide and the first 5 aa of the mature GALP .
  • HY-P5118
    Tat-peptide 190-208

    		Peptides Neurological Disease
    Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
  • HY-P0315
    Crosstide
    1 Publications Verification

    		 Akt Others
    Crosstide is a peptide analog of glycogen synthase kinase α/β fusion protein sequence which is a substrate for Akt.
  • HY-P1734
    Ac-MBP (1-11)

    		Peptides Neurological Disease
    Ac-MBP 1-11, a short peptide sequence, is the major encephalitogenic epitope in myelin basic protein (MBP) .
  • HY-P1311
    RLLFT-NH2

    		Peptides Others
    RLLFT-NH2 is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
  • HY-P10187
    α-Casein (90-96)

    		Peptides Others
    α-Casein (90-96) is a peptide with sequence of Arg-Tyr-Leu-Gly-Tyr-Leu-Glu .
  • HY-P10158
    PMAP-36

    Porcine cathelicidin PMAP-36

    		 Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
  • HY-P5353
    PA22-2

    IKVAV sequence; Laminin A-chain fragment

    		 Peptides Others
    PA22-2 (IKVAV sequence; Laminin A-chain fragment) is a biological active peptide. (This peptide is derived from mouse laminin a1 . Cell matrix substrate constituted with this peptide can promote neurite outgrowth.)
  • HY-P4425
    Gly-Phe-AMC

    		Peptides Others
    Gly-Phe-AFC is a fluorescent substrate, which is a peptide sequence composed of glycine and phenylalanine, linked to the fluorescent group AFC .
  • HY-P1311A
    RLLFT-NH2 TFA

    		Peptides Others
    RLLFT-NH2 TFA is a reversed amino acid sequence negative control peptide for TFLLR-NH2 .
  • HY-P4054
    IEIK 13

    		Peptides Others
    IEIK 13 is a self-assembling peptide (SAP) sequence. IEIK 13 can be used for the research of cartilage tissue engineering
  • HY-P10020
    Alrefimotide

    hTERT (660–689)

    		 Peptides Cancer
    Alrefimotide is a hTERT-derived immunogenic peptide. Alrefimotide has a sequence of ALFSVLNYERARRPGLLGASVLGLDDIHRA. Alrefimotide can be used in cancer immunotherapy research .
  • HY-P5118A
    Tat-peptide 190-208 TFA

    		Peptides Neurological Disease
    Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
  • HY-P5343
    p53 CBS

    p53 Consensus binding sequence

    		 MDM-2/p53 Others
    p53 CBS (p53 Consensus binding sequence) is a biological active peptide. (p53 consensus DNA binding site)
  • HY-P3702
    CEDAEVFKDSMVPGEK

    		TRP Channel Others
    CEDAEVFKDSMVPGEK is the rat vanilloid receptor subtype 1 (VR1) peptides sequence, can be used to determine the presence and distribution of VR1 .
  • HY-P4130
    MPS-Gαi2

    		Peptides Cancer
    MPS-Gαi2 is a peptide (membrane-permeable sequence). MPS-Gαi2 can be used for the research of cell adhesion .

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

  

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

  

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: