Search Result

Pathways Recommended:	Metabolic Enzyme/Protease

Results for "

Angiotensin-converting Enzyme (ACE)

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (4) Angiotensin-converting Enzyme (ACE) (153) 11β-HSD (3) Adrenergic Receptor (1) Apoptosis (16) Autophagy (3) Bradykinin Receptor (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) Dopamine Receptor (1) Drug Metabolite (12) Endogenous Metabolite (12) Influenza Virus (1) Interleukin Related (2) Isotope-Labeled Compounds (13) mAChR (2) MMP (4) Neprilysin (5) NF-κB (2) Opioid Receptor (1) Parasite (3) Reactive Oxygen Species (1) SARS-CoV (4) TNF Receptor (2) Toll-like Receptor (TLR) (2) Xanthine Oxidase (1)
By Research Areas:	Cancer (23) Cardiovascular Disease (140) Endocrinology (5) Infection (6) Inflammation/Immunology (16) Metabolic Disease (15) Neurological Disease (8)

By Targets:

Angiotensin Receptor (4)

Angiotensin-converting Enzyme (ACE) (153)

11β-HSD (3)

Adrenergic Receptor (1)

Apoptosis (16)

Autophagy (3)

Bradykinin Receptor (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (1)

Dopamine Receptor (1)

Drug Metabolite (12)

Endogenous Metabolite (12)

Influenza Virus (1)

Interleukin Related (2)

Isotope-Labeled Compounds (13)

mAChR (2)

MMP (4)

Neprilysin (5)

NF-κB (2)

Opioid Receptor (1)

Parasite (3)

Reactive Oxygen Species (1)

SARS-CoV (4)

TNF Receptor (2)

Toll-like Receptor (TLR) (2)

Xanthine Oxidase (1)

By Research Areas:

Cancer (23)

Cardiovascular Disease (140)

Endocrinology (5)

Infection (6)

Inflammation/Immunology (16)

Metabolic Disease (15)

Neurological Disease (8)

184

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Peptides

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an **angiotensin-converting enzyme** (ACE) inhibitor with an IC₅₀ of 81 μM.

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

Ramipril 2 Publications Verification HOE-498	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

Enalapril maleate 5+ Cited Publications MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an **angiotensin-converting enzyme (ACE)** inhibitor with antihypertensive activities.

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

RXP 407	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXP 407 is a potent and selective **Angiotensin-converting Enzyme (ACE) inhibitor with a K_i** of 12nM .

(+)-Chloroquine	Others	Others
(+)-Chloroquine is a aminoquinoline drug impairs in vitro the terminal glycosylation of angiotensin-converting enzyme 2 (ACE-2) .

Cilazapril Ro 31-2848	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

Cilazapril monohydrate 1 Publications Verification Ro 31-2848 monohydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

Cilazapril hydrochloride Ro 31-2848 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

Quinapril hydrochloride CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of **angiotensin-converting enzyme (ACE)** inhibitor. Teprotide can be used to study hypertensive .

Vicenin-1	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against **angiotensin-converting enzyme (ACE)** activity.

Fosinopril sodium 1 Publications Verification SQ28555	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease
Fosinopril Sodium is the ester prodrug of an **angiotensin-converting enzyme (ACE)** inhibitor, used for the treatment of hypertension and some types of chronic heart failure.

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

Fasidotril Alatriopril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Fasidotril is a dual inhibitor of neprilysin and **angiotensin-converting enzyme (ACE)** for the potential research of hypertension and congestive heart failure (CHF).

Enalapril MK-421	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Enalapril sodium MK-421 sodium	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) sodium is an angiotensin-converting enzyme *(ACE)* inhibitor, can be used for hypertensive diseases research .

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an **angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀** values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Zabicipril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Zabicipril is an orally active angiotensin-converting enzyme (ACE) inhibitor. Zabicipril can be used for the study of blood pressure and peripheral arterial insufficiency .

Zabicipril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Zabicipril hydrochloride is an orally active angiotensin-converting enzyme (ACE) inhibitor. Zabicipril hydrochloride can be used for the study of blood pressure and peripheral arterial insufficiency .

Ro 31-8472	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ro 31-8472 is a Cilazapril (HY-A0043) derivative. Ro 31-8472 is an **angiotensin-converting enzyme (ACE)** inhibitor .

Vicenin 3	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

A-58365B	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
A-58365B is an **Angiotensin-converting Enzyme (ACE)** inhibitor. A-58365B has antihypertensive effects .

RXPA 380	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXPA 380 is a C-terminal specific angiotensin-converting enzyme (ACE) inhibitor with a K_i of 3 nM. RXPA 380 inhibits C-domain mutants of human recombinant ACE with an IC₅₀ of 2.5 nM .

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

Resorcinolnaphthalein 2 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Inflammation/Immunology
Resorcinolnaphthalein is a specific **angiotensin-converting enzyme 2 (ACE2)** enhancer and activates ACE2 activity with an EC₅₀ value of 19.5 μM. Resorcinolnaphthalein can be used for the investigation of hypertension and renal fibrosis .

Moexipril	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Neurological Disease
Moexipril is an orally active inhibitor of **angiotensin-converting enzyme** (ACE), and becomes effective by being hydrolyzed to moexiprila (hydrochloride). Moexipril exhibits antihypertensive and neuroprotective effects ^- .

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to **Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin** A .

5-O-beta-D-Glucopyranosylmyricanol	Others	Others
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,473 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,473 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Type

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Chromogenic Substrates Amino acids and Derivatives
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Chromogenic Substrates
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

Cat. No.	Product Name	Target	Research Area

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-P3142

NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-P2616A

Mca-YVADAP-Lys(Dnp)-OH TFA	Cholinesterase (ChE) Caspase	Others
Mca-YVADAP-Lys(Dnp)-OH TFA is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of **angiotensin-converting enzyme (ACE)** inhibitor. Teprotide can be used to study hypertensive .

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P2605

Tuna AI	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Tuna AI, an **angiotensin-converting enzyme (ACE) inhibitor, exhibits IC₅₀** values of 1 μM and 2 μM for ACEs from bovine and rabbit lungs, respectively .

HY-P2616

Mca-YVADAP-Lys(Dnp)-OH	Caspase Angiotensin-converting Enzyme (ACE)	Others
Mca-YVADAP-Lys(Dnp)-OH is a fluorogenic substrate for caspase-1 and angiotensin-converting enzyme 2 (ACE2) .

HY-P3991

Bradykinin potentiator C	Angiotensin-converting Enzyme (ACE)	Metabolic Disease
Bradykinin potentiator C is a potent **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 7.1 μM for rabbit lung ACE. Bradykinin potentiator C is a postulated prototype of functional peptide .

HY-P4524

FA-Phe-Phe	Angiotensin-converting Enzyme (ACE)	Others
FA-Phe-Phe is a furylacryloyl (fa)-amino acid derivative, targeting to **Angiotensin-converting Enzyme (ACE). FA-Phe-Phe is also a specific substrate of Cathepsin** A .

HY-P10391

Ser-Ala-Pro	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ser-Ala-Pro is an X-Pro structure specific **angiotensin-converting enzyme (ACE)** inhibitory peptide. Ser-Ala-Pro has the potential for hypertension research .

HY-114424

H-Ile-Pro-Pro-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-114424A

H-Ile-Pro-Pro-OH hydrochloride 1 Publications Verification	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Ile-Pro-Pro-OH hydrochloride, a milk-derived peptide , inhibits angiotensin-converting enzyme (ACE) with an IC₅₀ of 5 μM . Antihypertensive tripeptides .

HY-P4279

Ovalbumin (154-159)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ovalbumin (154-159) is a fragment from ovalbumin. Ovalbumin (154-159) is a potent **angiotensin-converting enzyme (ACE)** inhibitor. Ovalbumin (154-159) can be used for research of hypertension .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the **angiotensin-converting enzyme** (ACE) .

HY-P4257

L-Isoleucyl-L-arginine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
L-Isoleucyl-L-arginine is a dipeptide formed from L-isoleucine and L-arginine residues. L-Isoleucyl-L-arginine is a potent **angiotensin-converting enzyme (ACE)** inhibitor. L-Isoleucyl-L-arginine can be used for research of hypertension .

HY-P0318

Hemorphin-7	Opioid Receptor Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Hemorphin-7 is a hemorphin peptide, an endogenous opioid peptide derived from the β-chain of hemoglobin. Hemorphin peptides exhibits antinociceptive and antihypertensive activities, activating opioid receptors and inhibiting angiotensin-converting enzyme (ACE).

HY-P4281

Ovotransferrin (328-332)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Neurological Disease
Ovotransferrin (328-332) has a protective activity on the blood pressure by inhibiting the **Angiotensin-Converting Enzyme (ACE), with the IC₅₀ of 20 μM. Ovotransferrin (328-332) fragment has an activity against Cholinesterase (ChE)**, implicating in Alzheimer’s diseases .

HY-P1444

Acein	Dopamine Receptor	Neurological Disease
Acein is a novel nonapeptide, H-Pro-Pro-Thr-Thr-Thr-Lys-Phe-Ala-Ala-OH. Acein can promote the release of dopamine. Acein targets angiotensin converting enzyme (ACE I). Angiotensin converting enzyme (ACE I) can be used in nervous system related research .

HY-P0266B

N-Acetyl-Ser-Asp-Lys-Pro acetate Ac-SDKP acetate	Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology
N-Acetyl-Ser-Asp-Lys-Pro (Ac-SDKP) acetate is a specific substrate for the N-terminal active site of angiotensin-converting enzyme (ACE). N-Acetyl-Ser-Asp-Lys-Pro acetate is a natural inhibitor of pluripotent hematopoietic stem cell proliferation. Anti-inflammatory and antifibrotic properties .

HY-P4554

H-Phe-Arg-OH	Endogenous Metabolite	Metabolic Disease
H-Phe-Arg-OH is a dipeptide containing phenylalanine and arginine. H-Phe-Arg-OH can be separated from Bradykinin (HY-P0206) through Angiotensin-converting enzyme (ACE, HY-P2983). H-Phe-Arg-OH can be used for metabolic research .

HY-P2072

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of **angiotensin converting enzyme (ACE)**. GF109 has antihypertensive effects .

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of **Angiotensin-converting enzyme** (ACE, HY-P2983) .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-P3976

Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is a blood pressure lowering peptide containing 4 amino acids. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine is an **angiotensin-converting Enzyme (ACE)** inhibitor. Lactalbumin B (50-53) Alpha [Lactorphin Alpha], bovine can be used in research of high blood pressure .

HY-W010991

N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly FAPGG	Angiotensin-converting Enzyme (ACE)	Others
N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly (FAPGG) is a synthetic cromogenic substrate for angiotensin converting enzyme (ACE) determination .

HY-137875

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

HY-P4654

H-Tyr-Lys-OH	Angiotensin-converting Enzyme (ACE)	Others
H-Tyr-Lys-OH is a dipeptide that can be used as a biomarker for AJH-1. H-Tyr-Lys-OH has a good binding affinity to angiotensin converting enzyme (ACE) .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P4641

H-Trp-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Trp-Phe-OH is a dipeptide consisting of tryptophan and phenylalanine (Trp-Phe). H-Trp-Phe-OH is also an antihypertensive peptide with inhibitory activity on angiotensin-converting enzyme (ACE), dose-dependently increases NO levels, and decreases endothelin-1 (ET-1) levels. H-Trp-Phe-OH (2 mg/kg; subcutaneous injection; 6 injections over 3 days) causes an increase in ovarian weight in female mice .

HY-P1792

Angiotensin II (1-4), human	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-P1792A

Angiotensin II (1-4), human TFA	Angiotensin Receptor	Metabolic Disease Endocrinology
Angiotensin II (1-4), human (TFA) is an endogenous peptide produced from AT I by angiotensin-converting-enzyme (ACE). Angiotensin II binds the AT II type 1 (AT1) receptor, stimulating GPCRs in vascular smooth muscle cells and increasing intracellular Ca ²⁺ levels. Angiotensin II also acts at the Na ⁺/H ⁺ exchanger in the proximal tubules of the kidney .

HY-W011258

H-Tyr-Phe-OH L-Tyrosyl-L-phenylalanine	Xanthine Oxidase Angiotensin-converting Enzyme (ACE)	Inflammation/Immunology Cancer
H-Tyr-Phe-OH (L-Tyrosyl-L-phenylalanine) is an orally active inhibitor of **Angiotensin converting enzyme** (ACE), with an inhibiton rate of 48% at 50 μM. H-Tyr-Phe-OH can be used as an biomarker for differentiating benign thyroid nodules (BTN) from thyroid cancer (TC). H-Tyr-Phe-OH exhibits xanthine oxidase inhibition (uric acid lowering) activity and serves as regulator in IL-8 production in neutrophil-like cells .

Species:	Human (8) Rhesus Macaque (2) Rat (1) Mouse (2) Cynomolgus (1)
Tag:	His (9) Avi (3) Fc (7)
Source:	HEK293 (13) Sf9 insect cells (2)

Cat. No.	Compare	Product Name	Species	Source

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7441

	ACE2 Protein, Human (HEK293, His, solution) 2 Publications Verification Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhAngiotensin-converting Enzyme/ACE-2, His; Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P72029

	ACE2 Protein, Macaca fascicularis (HEK293, hFc) ACE2; Angiotensin-converting Enzyme	Cynomolgus	HEK293
	ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

	ACE2 Protein, Human (HEK293, His) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P72808

	ACE2 Protein, Human (sf9, His) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) Angiotensin-converting Enzyme 2; ACE-Related Carboxypeptidase; Angiotensin-converting Enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.

HY-P74434

	ACE2 Protein, Mouse (HEK293, His) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) Angiotensin-converting Enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Chemical Structure

HY-B0231BS

Enalaprilat-d5 sodium
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231AS

Enalaprilat-d5
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0279S

Ramipril-d5
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-A0116S

Trandolaprilate-d5
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S1

Ramipril-d3
Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0279S2

Ramipril-d4
Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of **angiotensin-converting enzyme** (ACE), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-B0331AS

Enalapril D5 maleate
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active **angiotensin converting enzyme (ACE)** inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P80003

	ACE2 Antibody ACE-2; ACE 2; Angiotensin converting Enzyme 2; ACE related carboxypeptidase; ACEH; Angiotensin converting Enzyme homolog; Angiotensin converting Enzyme like protein; Angiotensin I converting Enzyme (peptidyl dipeptidase A) 2; Angiotensin I converting Enzyme 2; DKFZP434A014; EC 3.4.17; Angiotensin-converting Enzyme 2 precursor; ACE2_HUMAN; Angiotensin-converting Enzyme 2; ACE-related carboxypeptidase; Angiotensin-converting Enzyme homolog; Metalloprotease MPROT15; Processed Angiotensin-converting Enzyme 2.	WB, ICC/IF, IHC-P, IP	Human, Mouse, Hamster
	ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

HY-P81084

	ACE Antibody Angiotensin converting Enzyme 1; ACE; ACE-T; Angiotensin-converting Enzyme isoform 1precursor; Dipeptidyl carboxy peptidase 1; Kininase II; ACE-1; testis-specific isoform precursor. ACE 1; ACE T; ACE1; Angiotensin converting Enzyme somatic isoform; Angiotensin converting Enzyme testis specific isoform; Angiotensin I converting Enzyme; Angiotensin I converting Enzyme 1; Angiotensin I converting Enzyme peptidyl dipeptidase A 1; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; MVCD3; Peptidase P; Peptidyl dipeptidase A; Testicular ECA; ACE_HUMAN.	WB, IHC-P, FC	Human, Mouse
	ACE Antibody is an unconjugated, approximately 150 kDa, rabbit-derived, anti-ACE monoclonal antibody. ACE Antibody can be used for: WB,IHC-P,FC expriments in human, mouse background without labeling.

HY-P82349

	ACE Antibody (YA2094) ACE; Dipeptidyl carboxypeptidase I; Kininase II; Angiotensin converting Enzyme 1 Antibody	WB, IHC-P	Mouse, Rat
	Angiotensin Converting Enzyme 1 Antibody (YA2094) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2094), targeting Angiotensin Converting Enzyme 1, with a predicted molecular weight of 151 kDa (observed band size: 180 kDa). Angiotensin Converting Enzyme 1 Antibody (YA2094) can be used for WB, IHC-P experiment in mouse, rat background.