1. Search Result
Search Result
Results for "

MIP

" in MedChemExpress (MCE) Product Catalog:

24

Inhibitors & Agonists

4

Peptides

2

Natural
Products

51

Recombinant Proteins

7

Antibodies

1

Oligonucleotides

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-156371

    PI3K Cardiovascular Disease
    MIPS-21335 is an PI3KC2α inhibitor (IC50: 7 nM). MIPS-21335 also inhibits PI3KC2β, p110α, p110β and p110δ (IC50: 0.043, 0.140, 0.386, 0.742 μM). MIPS-21335 has antithrombotic effect .
    MIPS-21335
  • HY-139644

    Adenosine Receptor Neurological Disease
    MIPS521 is a positive allosteric modulator of adenosine A1 receptor (A1AR). MIPS521 also has a lower A1R allosteric affinity (pKB=4.95; KB=11 μM). MIPS521 exhibits pain-relieving effects in vivo through modulation of the increased levels of endogenous adenosine .
    MIPS521
  • HY-129615

    PSMA Cancer
    MIP-1072 is a small molecule specific prostate-specific membrane antigen (PSMA) inhibitor. MIP-1072 inhibits the glutamate carboxypeptidase activity of PSMA with an Ki value of 4.6 nM. MIP-1072 is promising for research of prostate cancer .
    MIP-1072
  • HY-168149

    Others Cancer
    Mip-IN-2 (compund 5b) is a macrophage infection-enhancing protein (MIP) protein .
    Mip-IN-2
  • HY-149861

    Others Infection
    Mip-IN-1(S,S-28i)is a new rapamycin-derived macrophage infectivity potentiator (Mip) inhibitor. Mip-IN-1 displays strong anti-enzymatic activity against the Mip proteins of Neisseria meningitidis and Neisseria gonorrhoeae and substantially improved the ability of macrophages to kill the bacteria .
    Mip-IN-1
  • HY-123733

    RPS-001

    PSMA Others Cancer
    MIP-1095 potently inhibits the glutamate carboxypeptidase activity of PSMA (Ki =0.24 nM) .
    MIP-1095
  • HY-123733A

    RPS-001 TFA

    PSMA Cancer
    MIP-1095 (RPS-001) TFA is a potent inhibitor of PSMA with good biodistribution and efficient targeting of tumor lesions. In applications, MIP-1095 TFA will be isotopically labeled ( 131I labeled) as an imaging probe to indicate tumor progression. And 131I-MIP-1095 showed higher renal uptake in mice .
    MIP-1095 TFA
  • HY-RS08460

    Small Interfering RNA (siRNA) Others

    MIP Human Pre-designed siRNA Set A contains three designed siRNAs for MIP gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

    MIP Human Pre-designed siRNA Set A
    MIP Human Pre-designed siRNA Set A
  • HY-120265

    PI3K Cardiovascular Disease
    MIPS-9922 is a potent and selective PI3Kβ inhibitor with an IC50 of 63 nM. MIPS-9922 inhibits PI3Kβ with >30-fold higher potency than PI3Kδ. MIPS-9922 blocks PI3K mediated activation of platelet glycoprotein αIIbβ3 activation and platelet adhesion in vitro. MIPS-9922 shows anti-platelet and anti-thrombotic activities .
    MIPS-9922
  • HY-123661

    Others Neurological Disease
    MIPS1455 is a light-activated M1 muscarinic acetylcholine receptor ligand with irreversible binding activity to the allosteric site of the receptor. MIPS1455 is a drug target under investigation for the suppression of cognitive deficits and may become a valuable molecular tool for further investigation of allosteric interactions of the receptor .
    MIPS1455
  • HY-B0498
    Bindarit
    10+ Cited Publications

    AF2838

    CCR Neurological Disease Inflammation/Immunology Endocrinology Cancer
    Bindarit (AF2838) is a selective inhibitor of the monocyte chemotactic proteins MCP-1/CCL2, MCP-3/CCL7, and MCP-2/CCL8, and no effect on other CC and CXC chemokines such as MIP-1α/CCL3, MIP-1β/CCL4, MIP-3/CCL23. Bindarit also has anti-inflammatory activity .
    Bindarit
  • HY-P4191

    MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN

    CCR Inflammation/Immunology
    Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human)
  • HY-P4191A

    CCR Inflammation/Immunology
    Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
    Met-RANTES (human) (acetate)
  • HY-149650

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1
  • HY-149650A

    Toll-like Receptor (TLR) Inflammation/Immunology
    TLR4 agonist-1 (TEA) (compound 17a) is a potent agonist of Toll-like Receptor 4 (TLR4), and induces the generation of MIP-1β in RAW 264.7 and MM6 cells .
    TLR4 agonist-1 TEA
  • HY-103360B

    CCR Inflammation/Immunology
    trans-J-113863 is a potent chemokine CCR1 and CCR3 receptor antagonist, and inhibits MIP-1α-induced chemotaxis in CCR1 transfectants and eotaxin-induced chemotaxis in CCR3 transfectants with IC50 of 9.57 and 93.8 nM,respectively .
    trans-J-113863
  • HY-P4200

    Antibiotic Bacterial Infection
    Lugdunin is an antibiotic peptide. Lugdunin inhibits bacteria by dissipating their membrane potential. Lugdunin is active against Gram-positive bacteria, such as S. aureus, and reduces S. aureus skin and nasal colonization. Lugdunin induces LL-37 and CXCL8/MIP-2 in human keratinocytes and mouse skin .
    Lugdunin
  • HY-161901

    E1/E2/E3 Enzyme Inflammation/Immunology
    BC-1293 is an inhibitor for E3 ligase subunit FBXO24. BC-1293 disrupts the interaction between FBXO24 and aspartyl-tRNA synthetase (DARS2) and increases the level of DARS2. BC-1293 increases levels of IL-1β, IL-9, MIP-2, and TNF α, and exhibits immunostimulatory activity in mice .
    BC-1293
  • HY-B0155

    SCH 417690; SCH-D; MK-7690 free base

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc
  • HY-B0155B

    SCH 417690 malate; SCH-D malate; MK-7690

    CCR HIV Infection Cancer
    Vicriviroc (SCH 417690) malate is an orally active CCR5 antagonist with the IC50 of 10 nM, and also inhibts MIP-1α and intracellular calcium release induced by the ligand RANTES (10 nM) with the IC50 values of 0.91 nM and 16 nM,,respectively. Vicriviroc malate can inhibits human immunodeficiency virus type 1 (HIV-1) infection, and can also used for study of cancer .
    Vicriviroc malate
  • HY-B2176R

    Endogenous Metabolite Metabolic Disease Inflammation/Immunology
    ATP (Standard) is the analytical standard of ATP. This product is intended for research and analytical applications. ATP (Adenosine 5'-triphosphate) is a central component of energy storage and metabolism in vivo. ATP provides the metabolic energy to drive metabolic pumps and serves as a coenzyme in cells. ATP is an important endogenous signaling molecule in immunity and inflammation . In Vitro: ATP (5 mM; 1 hour) co-treatment with LPS (1 μg/mL) has a synergistic effect on the activation of the NLRP3 inflammasome in HGFs .
    ATP (2 mM; 0.5-24 hours) induces secretion of IL-1β, KC and MIP-2 from BMDMs in a caspase-1 activation-dependent manner .
    ATP promotes neutrophil chemotaxis in vitro .
    In Vivo: ATP (50 mg/kg; i.p.) protects mice against bacterial infection in vivo .
    ATP induces the secretion of IL-1β, KC and MIP-2 and neutrophils recruitment in vivo .
    ATP (Standard)
  • HY-W014081

    Ethyl 2-oxo-2H-chromene-3-carboxylate

    Others Others
    Ethyl 3-coumarincarboxylate is a coumarin derivative. Ethyl 3-coumarincarboxylate can be used as a pseudo-template to give a molecularly imprinted polymer (MIP) that has a fairly specific recognition capability for aflatoxins .
    Ethyl 3-coumarincarboxylate
  • HY-15544

    CCR Inflammation/Immunology
    CCR1 antagonist 10 (example 1) is a potent and orally active CCR1 antagonist. CCR1 antagonist 10 inhibits 125I-MIP-1α binding to THP-1 cell membranes with an Ki value of 2.3 nM .
    CCR1 antagonist 10
  • HY-19974
    TAK-220
    2 Publications Verification

    CCR HIV Infection Endocrinology
    TAK-220 is a selective and orally bioavailable CCR5 antagonist, with IC50s of 3.5 nM and 1.4 nM for inhibition on the binding of RANTES and MIP-1α to CCR5, respectively, but shows no effect on the binding to CCR1, CCR2b, CCR3, CCR4, or CCR7; TAK-220 also selectively inhibits HIV-1, with EC50s of 1.2 nM (HIV-1 KK), 0.72 nM (HIV-1 CTV), 1.7 nM (HIV-1 HKW), 1.7 nM (HIV-1 HNK), 0.93 nM (HIV-1 HTN), and 0.55 nM (HIV-1 HHA), and EC90s of 12 nM (HIV-1 KK), 5 nM (HIV-1 CTV), 12 nM (HIV-1 HKW), 28 nM (HIV-1 HNK), 15 nM (HIV-1 HTN), and 4 nM (HIV-1 HHA) in PBMCs.
    TAK-220

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: