Search Result

Results for "

Derivative peptides

" in MedChemExpress (MCE) Product Catalog:

By Targets:	ADC Linker (1) Amino Acid Derivatives (58) Amyloid-β (2) Angiotensin Receptor (2) Angiotensin-converting Enzyme (ACE) (1) Apoptosis (1) Bacterial (4) Bcl-2 Family (1) Biochemical Assay Reagents (52) Bombesin Receptor (1) Calcium Channel (1) Caspase (1) Cholinesterase (ChE) (2) CXCR (3) Drug-Linker Conjugates for ADC (2) Endogenous Metabolite (1) Fluorescent Dye (12) Fungal (1) GCGR (5) GSK-3 (2) Interleukin Related (1) Isotope-Labeled Compounds (2) Legumain (1) Neurokinin Receptor (1) Neuropeptide Y Receptor (2) Neurotensin Receptor (1) Opioid Receptor (4) Parasite (1) Radionuclide-Drug Conjugates (RDCs) (20) Reactive Oxygen Species (2) SARS-CoV (1) Somatostatin Receptor (2)
By Research Areas:	Cancer (21) Cardiovascular Disease (4) Endocrinology (3) Infection (7) Inflammation/Immunology (6) Metabolic Disease (9) Neurological Disease (12)
Click Chemistry:	DBCO (1) Azide (3) Alkynes (4)

172

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

MCE Kits

Natural
Products

Isotope-Labeled Compounds

Click Chemistry

DOTA-tris(tBu)ester NHS ester	Biochemical Assay Reagents	Cancer
DOTA-tris(tBu)ester NHS ester is a derivative of DOTA for the labeling of peptides and antibodies .

Fmoc-D-Dap(Boc)-OH	Radionuclide-Drug Conjugates (RDCs) Amino Acid Derivatives	Others
Fmoc-D-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as DOTA-modified peptides and their metal chelates with cancer diagnostic effects .

Fmoc-Dap(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bicyclic peptide tachykinin NK2 antagonists .

H-Cys-Val-2-Nal-Met-OH	Others	Others
H-Cys-Val-2-Nal-Met-OH is a peptide. H-Cys-Val-2-Nal-Met-OH is a peptidomimetic derivative that can be used to label short peptide sequences .

2,6-Dimethyl-L-tyrosine Dmt	Opioid Receptor	Neurological Disease
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides .

Fmoc-Tic-OH	Amino Acid Derivatives	Others
Fmoc-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as the biotinylated derivative of the opioid receptor antagonist TIPP .

Boc-Leu-OH hydrate N-Boc-L-leucine monohydrate	Amino Acid Derivatives	Others
Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .

Fmoc-α-Me-Leu-OH	Amino Acid Derivatives	Others
Fmoc-α-Me-Leu-OH is a leucine derivative with an Fmoc protecting group, which can be used to synthesize peptides with oxytocin receptor agonist activity .

Fmoc-L-cysteic acid	Amino Acid Derivatives	Others
Fmoc-L-cysteic acid is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize triarylsulfonium compounds for radiolabeling of peptides .

Fmoc-D-Dab(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-D-Dab(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize peptides with antibacterial activity .

Fmoc-Pen(Trt)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II .

Boc-L-Arg(Mtr)-OH Boc-Arg(Mtr)-OH	Amino Acid Derivatives	Others
Boc-L-Arg(Mtr)-OH (Boc-Arg(Mtr)-OH) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antithrombotic activity .

Boc-Gln(Xan)-OH N-Boc-N'-xanthyl-L-glutamine	Amino Acid Derivatives	Others
Boc-Gln(Xan)-OH (N-Boc-N'-xanthyl-L-glutamine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antigenic activity .

Fmoc-Pen(Acm)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .

Fmoc-5-Ava-OH	Amino Acid Derivatives	Others
Fmoc-5-Ava-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize fatty acid-based dimeric peptides with PSD-95 inhibitory activity .

Fmoc-Oic-OH	Amino Acid Derivatives	Others
Fmoc-Oic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

Dynorphin (2-17), amide (porcine)	Endogenous Metabolite Opioid Receptor	Neurological Disease
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation .

Fmoc-D-Tic-OH	Amino Acid Derivatives	Others
Fmoc-D-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

Boc-β-Ala-ol 3-(Boc-amino)-1-propanol	Amino Acid Derivatives	Others
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity .

Fmoc-Arg(Pbf)-OH	Amino Acid Derivatives	Others
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

Fmoc-Asp(OtBu)-OH 4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH	Amino Acid Derivatives	Others
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

7-Methyl-DL-tryptophan 7-Methyltryptophan	Amino Acid Derivatives	Infection
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .

Fmoc-D-4-Aph(cBm)-OH	Amino Acid Derivatives	Others
Fmoc-D-4-Aph(cBm)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize biologically active peptide mimetics, such as Ac-D2Nal-D4Cpa-D3Pal-Ser-4Aph/4Amf(P)-D4Aph/D4Amf(Q)-Leu-ILys-Pro-DAla-NH2 with gonadotropin-releasing hormone (GnRH) antagonist activity .

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

Cbz-D-Leu-Val-Boc	Biochemical Assay Reagents	Cancer
Cbz-D-Leu-Val-Boc is a peptide derivative.

Fmoc-D-3,3-diphenylalanine	Amino Acid Derivatives	Others
Fmoc-D-3,3-diphenylalanine is a peptide derivative.

(Leu31,Pro34)-Peptide YY (human)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

Exendin-3/4 (59-86)	GCGR	Metabolic Disease
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

[3,5 Diiodo-Tyr7] Peptide T	Amino Acid Derivatives	Others
[3,5 Diiodo-Tyr7] Peptide T is a threonine derivative .

L-Homotyrosine	Others	Others
L-Homotyrosine is a tyrosine derivative that can be used for solid-phase peptide synthesis .

p-Diazobenzoyl-biocytin chloride DBB chloride	Biochemical Assay Reagents	Others
p-Diazobenzoyl-biocytin chloride is a biotin derivative that can be used for the labeling of tyrosine and histidines in peptides and proteins .

Anditixafortide	CXCR	Cancer
Anditixafortide (Pentixather) is an endoradiotherapeutic vector. Anditixafortide is a CXCR4-targeting peptide derivative .

H-L-Cys(MDNPE)-OH hydrochloride	Others	Others
H-L-Cys(MDNPE)-OH hydrochloride is a cysteine derivative with a short peptide sequence attached to the thiol group of cysteine.

Boc-D-norleucine Boc-D-Nle-OH; N-BOC-D-norleucine	Amino Acid Derivatives	Others
Boc-D-norleucine (Boc-D-Nle-OH) is a leucine derivative that can be used for peptide synthesis .

Fmoc-Ala-Thr(psi(Me,Me)pro)-OH	Amino Acid Derivatives	Others
Fmoc-Ala-Thr(psi(Me,Me))-OH is an Fmoc protected alanine derivative and can be used for peptide synthesis.

Fmoc-L-Homoarginine hydrochloride	Amino Acid Derivatives	Others
Fmoc-L-Homoarginine hydrochloride is a derivative of amino acid with protecting groups. Fmoc-L-Homoarginine hydrochloride can be used for synthesis of homoarginine containing peptide .

(Leu31,Pro34)-Peptide YY (human) (TFA)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

N-Fmoc-O-ethyl-L-homoserine	Amino Acid Derivatives	Others
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .

Omiganan, FITC labeled	Bacterial Fungal	Infection
Omiganan, FITC labeled is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines .

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

Fmoc-D-Cit-OH	Amino Acid Derivatives	Others
Fmoc-D-Cit-OH is citrulline with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as H-Dmt-D-Cit-Aba-b-Ala-NMe-30,50-(CF3)2-Bn and H-Dmt-D-Cit-Aba-b-Ala-NMe-Bn with neurokinin-1 antagonist activity .

ivDde-Lys(Fmoc)-OH	Amino Acid Derivatives	Others
ivDde-Lys(Fmoc)-OH is a derivative of amino acid with protecting groups. ivDde-Lys(Fmoc)-OH can be used for peptide synthesis .

Boc-Lys(ivdde)-OH	Amino Acid Derivatives	Others
Boc-Lys(ivdde)-OH is a derivative of amino acid. Boc-Lys(ivdde)-OH can be used for synthesis of lysine containing peptide .

Fmoc-NIP-OH Fmoc-3-carboxypiperidine	Amino Acid Derivatives	Others
Fmoc-NIP-OH (Fmoc-3-carboxypiperidine) is a Fmoc-protected amino acid derivative commonly used in peptide synthesis .

DOTA-EB-TATE	Somatostatin Receptor Radionuclide-Drug Conjugates (RDCs)	Cancer
DOTA-EB-TATE is composed of SST peptide derivative, DOTA-octreotate conjugated a common to an Evans blue analog (EB). DOTA-EB-TATE is a peptide drug conjugate (PDC) improves the pharmacokinetics of SSTR2 analogs and reduces PRRT toxicity .

Cat. No.	Product Name

HY-L105

Peptide Library

1,686 compounds

Peptides are a group of biologically active substances that are involved in various cellular functions of organisms. Peptides are often used in functional analysis, vaccine research and especially in the field of drug research and development. At present, more than 80 peptide drugs have reached the market for a wide range of diseases, including diabetes, cancer, osteoporosis, multiple sclerosis, HIV infection and chronic pain.

MedChemExpress (MCE) offers a comprehensive collection of 1,686 peptides, including bioactive peptides, amino acid derivatives, and blocking peptides. MCE Peptide Library can be used for peptide library screening, peptide drug discovery, vaccine development, target verification, structural activity research, etc.

Cat. No.	Product Name	Type

HY-W027544

MCA	Fluorescent Dyes/Probes
MCA is a coumarin derivative. MCA quantitates platelet-activating factor by high-performance liquid chromatography with fluorescent detection. MCA can modify FRET peptide substrates for analyzing protease activities .

HY-D1085

AMCA-X SE	Fluorescent Dyes/Probes
AMCA-X-SE is a coumarin derivative that generates fixed blue fluorescence and an NHS-activated ester that forms stable amide bonds with primary amine groups. It is used as a reactive dye for labeling amino groups of peptides, proteins, and oligonucleotides. Maximum excitation/emission wavelength: 354/442 nm .

HY-W324458

MCA succinimidyl ester	Fluorescent Dyes/Probes
MCA succinimidyl ester is a derivative of MCA (HY-W027544). MCA succinimidyl ester has succinimidyl ester can react selectively with amines. MCA succinimidyl ester can be used as peptide substrate for fluorescence resonance energy transfer .

HY-149117

AF430 NHS ester	Fluorescent Dyes/Probes
AF430 NHS ester is an AF 430 maleimide is a derivative of the yellow fluorescent dye AF 430. AF430 has an excitation wavelength of 425 nm and an emission wavelength of 542 nm. AF430 NHS ester can be uesd for the labeling of amino-groups in peptides, proteins, and oligonucleotides. To achieve specific coupling of dye labels and biomolecules .

HY-D1848

Sulfo-Cy3-NHS disodium	Fluorescent Dyes/Probes
Sulfo-Cy3-NHS disodium is a derivative of Cy3 (Cyanine3) (HY-D0822) dye containing sulfonate ions. Sulfo-Cy3-NHS disodium contains sulfonate ions and has improved water solubility. Sulfo-Cy3-NHS disodium can label biomolecules containing amine groups, such as proteins, antibodies or peptides.

HY-D2152

Cy5-PEG3-SCO	Fluorescent Dyes/Probes
Cy5-PEG3-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 3 PEG units. Cy5-PEG3-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2158

Cy5-PEG7-SCO	Fluorescent Dyes/Probes
Cy5-PEG7-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 7 PEG units. Cy5-PEG7-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2122

Cy3-PEG2-SCO	Fluorescent Dyes/Probes
Cy3-PEG2-SCO is a dye derivative of Cyanine 3 (Cy3) (HY-D0822) containing 2 PEG units. Cy3-PEG2-SCO carries a SCO group that can be covalently bound to an amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2124

Cy3-PEG7-SCO	Fluorescent Dyes/Probes
Cy3-PEG7-SCO is a dye derivative of Cyanine 3 (Cy3) (HY-D0822) containing 7 PEG units. Cy3-PEG7-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D2153

Cy5-PEG2-SCO	Fluorescent Dyes/Probes
Cy5-PEG2-SCO is a dye derivative of Cyanine 5 (Cy5) (HY-D0821) containing 2 PEG units. Cy5-PEG2-SCO has a SCO group that can be covalently bonded to the amino group. SCO is often used to react with amino acid residues of proteins or peptides, particularly lysine.

HY-D1653

BDP 581/591 NHS ester

Fluorescent Dyes/Probes

BDP 581/591 NHS ester is a a borondipyrromethene dye (Ex=585 nm, Em=594 nm) that has relatively long fluorescence lifetime and two photon excitation cross section. BDP 581/591 NHS ester can be used for fluorescence polarization analysis and also reacts with reactive oxygen species (ROS) and alter fluorescence. BDP 581/591 NHS ester is also an NHS ester derivative that can be used to bind primary and secondary amine groups of proteins, peptides and other molecules.

HY-66019

FITC

40+ Cited Publications

Fluorescein 5-isothiocyanate

Fluorescent Dyes/Probes

FITC (Fluorescein Isothiocyanate), is one of the green fluorescein derivatives widely used in biology. FITC has the characteristics of high absorptivity and excellent fluorescence quantum yield. The isothiocyanate group of FITC can be combined with amino, sulfhydryl, imidazole, tyrosyl, carbonyl and other groups on the protein, so as to achieve protein labeling including antibodies and lectins. In addition to its use as a protein marker, FITC can also be used as a fluorescent protein tracer to rapidly identify pathogens by labeling antibodies, or for microsequencing of proteins and peptides (HPLC). The maximum excitation wavelength of FITC is 494 nm. Once excited, it fluoresces yellow-green at a maximum emission wavelength of 520 nm. In addition, FITC is also a hapten that can induce contact hypersensitivity (CHS) and induce an atopic dermatitis model .

Cat. No.	Product Name	Type

HY-158067

Deferoxamine-DBCO DFO-DBCO	Chelators
Deferoxamine-DBCOis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DFO derivative used for tumor pre-targeting. Deferoxamine-DBCO can be used for conjugation of peptides and radionuclides.

HY-W088413

DOTA-amide	Chelators
DOTA-amideis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-amide can be used for conjugation of peptides and radionuclides.

HY-W782078

Butyne-DOTA	Chelators
Butyne-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Butyne-DOTA can be used for conjugation of peptides and radionuclides.

HY-W678394

DOTA-Thiol	Chelators
DOTA-Thiolis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-Thiol can be used for conjugation of peptides and radionuclides.

HY-W539893

NODAGA-tris(t-Bu ester) NODAG	Chelators
NODAGA-tris(t-Bu ester) (NODAG) is a NODAGA derivative. NODAGA-tris(t-Bu ester) can be used to label peptides, antibodies, etc., and subsequently radiolabeled for PET imaging .

HY-156144

p-Diazobenzoyl-biocytin chloride DBB chloride	Gene Sequencing and Synthesis
p-Diazobenzoyl-biocytin chloride is a biotin derivative that can be used for the labeling of tyrosine and histidines in peptides and proteins .

HY-138134

NOTP	Chelators
NOTPis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NOTP can be used for conjugation of peptides and radionuclides.

HY-134418A

NOTA trihydrochloride	Chelators
NOTA (trihydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NOTA (trihydrochloride) can be used for conjugation of peptides and radionuclides.

HY-138269A

Barzuxetan hydrochloride CHX-A''-DTPA-NCS hydrochloride	Chelators
Barzuxetan (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. Barzuxetan (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-158072

DOTAM-NHS-ester	Chelators
DOTAM-NHS-esteris a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTAM-NHS-ester can be used for conjugation of peptides and radionuclides.

HY-W717830

CB-Cyclam	Chelators
CB-Cyclamis a bifunctional chelator (Bifunctional Chelator; BFC), which is a main chain Cyclen derivative of the macrocyclic ligand tetradecane. CB-Cyclam can be used for conjugation of peptides and radionuclides.

HY-W717743

DOTAM-mono-acid	Chelators
DOTAM-mono-acidis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTAM-mono-acid can be used for conjugation of peptides and radionuclides.

HY-W726767

DO2A	Chelators
DO2Ais a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DO2A can be used for conjugation of peptides and radionuclides.

HY-W717782

Bz-DTPA hydrochloride	Chelators
Bz-DTPA (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. Bz-DTPA (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W835525

N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine	Biochemical Assay Reagents
N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine is a biotinylated biochemical assay reagent that forms a layer of biotin derivative on the surface of ORMOCER, and triggers the assembly of peptide nanostructured fibers. N-(Biotinoyl)-N''-(iodoacetyl)ethylenediamine can be used for 3D assembly of peptides in molecular electronics, biosensors, and tissue engineering .

HY-W087027A

Maleimide-NOTA TFA	Chelators
Maleimide-NOTA (TFA)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. Maleimide-NOTA (TFA) can be used for conjugation of peptides and radionuclides.

HY-158077

(R)-tetraMe-Tetraxetan (R)-tetraMe-DOTA	Chelators
(R)-tetraMe-Tetraxetanis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. (R)-tetraMe-Tetraxetan can be used for conjugation of peptides and radionuclides.

HY-W250844A

DO3A trisodium	Chelators
DO3A (trisodium)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DO3A (trisodium) can be used for conjugation of peptides and radionuclides.

HY-W539916

Azido-mono-amide-DOTA	Chelators
Azido-mono-amide-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Azido-mono-amide-DOTA can be used for conjugation of peptides and radionuclides.

HY-128890A

DOTA-NHS-ester hexafluorophosphate TFA	Chelators
DOTA-NHS-ester (hexafluorophosphate TFA)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-NHS-ester (hexafluorophosphate TFA) can be used for conjugation of peptides and radionuclides.

HY-W717779

4-Aminobutyl-DOTA	Chelators
4-Aminobutyl-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. 4-Aminobutyl-DOTA can be used for conjugation of peptides and radionuclides.

HY-A0074

DTPA-tetra (t-Bu ester) tetra-tBu-DTPA	Chelators
DTPA-tetra (t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. DTPA-tetra (t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W717781A

p-NH₂-Bn-DTPA hydrochloride	Chelators
p-NH?-Bn-DTPA (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. p-NH?-Bn-DTPA (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W782088A

p-NH₂-Bn-PCTA hydrochloride	Chelators
p-NH?-Bn-PCTA (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. p-NH?-Bn-PCTA (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W782087A

p-SCN-Bn-PCTA hydrochloride	Chelators
p-SCN-Bn-PCTA (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. p-SCN-Bn-PCTA (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W782083

p-SCN-Bn-NOTA trihydrochloride	Chelators
p-SCN-Bn-NOTA (trihydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. p-SCN-Bn-NOTA (trihydrochloride) can be used for conjugation of peptides and radionuclides.

HY-156038

(S)-p-SCN-Bn-DOTA	Chelators
(S)-p-SCN-Bn-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. (S)-p-SCN-Bn-DOTA can be used for conjugation of peptides and radionuclides.

HY-W749627

NO2A-Butyne	Chelators
NO2A-Butyneis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Butyne can be used for conjugation of peptides and radionuclides.

HY-158068

Maleimido-mono-amide-DTPA TFA	Chelators
Maleimido-mono-amide-DTPA (TFA)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. Maleimido-mono-amide-DTPA (TFA) can be used for conjugation of peptides and radionuclides.

HY-W802013

DOTA-4AMP	Chelators
DOTA-4AMPis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. DOTA-4AMP can be used for conjugation of peptides and radionuclides.

HY-131673A

(S)-p-SCN-Bn-TCMC hydrochloride	Chelators
(S)-p-SCN-Bn-TCMC (hydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. (S)-p-SCN-Bn-TCMC (hydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W451440

Butyne-DOTA-tris(t-butyl ester)	Chelators
Butyne-DOTA-tris(t-butyl ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Butyne-DOTA-tris(t-butyl ester) can be used for conjugation of peptides and radionuclides.

HY-W717800A

NO2A-Azide trihydrochloride	Chelators
NO2A-Azide (trihydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Azide (trihydrochloride) can be used for conjugation of peptides and radionuclides.

HY-156138A

CB-TE2A tetrahydrochloride	Chelators
CB-TE2A (tetrahydrochloride)is a bifunctional chelator (Bifunctional Chelator; BFC), which is a TETA derivative of the macrocyclic ligand tetradecane backbone. CB-TE2A (tetrahydrochloride) can be used for conjugation of peptides and radionuclides.

HY-W717833

NO2A-(t-Bu ester)	Chelators
NO2A-(t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-(t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W717742

p-NO2-Bn-Cyclen	Chelators
p-NO2-Bn-Cyclenis a bifunctional chelator (Bifunctional Chelator; BFC), which is a derivative of the macrocyclic ligand dodecane backbone Cyclen. p-NO2-Bn-Cyclen can be used for conjugation of peptides and radionuclides.

HY-48876

p-NH2-Bn-DOTA	Chelators
p-NH2-Bn-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. p-NH2-Bn-DOTA can be used for conjugation of peptides and radionuclides.

HY-W782075

p-NO2-Bn-DOTA	Chelators
p-NO2-Bn-DOTAis a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. p-NO2-Bn-DOTA can be used for conjugation of peptides and radionuclides.

HY-158066

p-NH2-Bn-NOTA hydrochloride hydrate	Chelators
p-NH2-Bn-NOTA (hydrochloride hydrate)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. p-NH2-Bn-NOTA (hydrochloride hydrate) can be used for conjugation of peptides and radionuclides.

HY-158069

p-NH₂-Bn-DTPA-penta (t-Bu ester)	Chelators
p-NH?-Bn-DTPA-penta (t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. p-NH?-Bn-DTPA-penta (t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W250929

Maleimido-mono-amide-DOTA-tris(t-Bu ester)	Chelators
Maleimido-mono-amide-DOTA-tris(t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Maleimido-mono-amide-DOTA-tris(t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W460274

4-Aminobutyl-DOTA-tris(t-butyl ester)	Chelators
4-Aminobutyl-DOTA-tris(t-butyl ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. 4-Aminobutyl-DOTA-tris(t-butyl ester) can be used for conjugation of peptides and radionuclides.

HY-148646A

p-NH2-CHX-A"-DTPA hydrochloride hydrate	Chelators
p-NH2-CHX-A"-DTPA (hydrochloride hydrate)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DPTA derivative used for tumor pre-targeting. p-NH2-CHX-A"-DTPA (hydrochloride hydrate) can be used for conjugation of peptides and radionuclides.

HY-W749614

NO2A-Butyne-bis(t-Butyl ester)	Chelators
NO2A-Butyne-bis(t-Butyl ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic NOTA derivative used for tumor pre-targeting. NO2A-Butyne-bis(t-Butyl ester) can be used for conjugation of peptides and radionuclides.

HY-W749603

Fmoc-L-Lys-mono-amide-DOTA-tris(t-Bu ester)	Chelators
Fmoc-L-Lys-mono-amide-DOTA-tris(t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. Fmoc-L-Lys-mono-amide-DOTA-tris(t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W782081

p-SCN-Bn-oxo-DO3A	Chelators
p-SCN-Bn-oxo-DO3Ais a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. p-SCN-Bn-oxo-DO3A can be used for conjugation of peptides and radionuclides.

HY-W717760

p-NH2-Bn-DOTA-tetra(t-Bu ester)	Chelators
p-NH2-Bn-DOTA-tetra(t-Bu ester)is a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. p-NH2-Bn-DOTA-tetra(t-Bu ester) can be used for conjugation of peptides and radionuclides.

HY-W782080

p-NH2-Bn-oxo-DO3A	Chelators
p-NH2-Bn-oxo-DO3Ais a bifunctional chelator (Bifunctional Chelator; BFC) and a macrocyclic DOTA derivative used for tumor pre-targeting. p-NH2-Bn-oxo-DO3A can be used for conjugation of peptides and radionuclides.

HY-134393B

6-Me-ATP (trisodium) solution (100mM) N6-Methyl-ATP (trisodium) solution (100mM)	Gene Sequencing and Synthesis
6-Me-ATP (N6-Methyl-ATP) trisodium solution (100mM) is a N ⁶-modified ATP derivative. 6-Me-ATP trisodium shows excellent binding affinity to GSK3, serving as the phosphate group donor for GSK3β-catalyzed phosphorylation of its substrate peptide .

Cat. No.	Product Name	Target	Research Area

HY-W046355

Fmoc-D-Dap(Boc)-OH	Radionuclide-Drug Conjugates (RDCs) Amino Acid Derivatives	Others
Fmoc-D-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as DOTA-modified peptides and their metal chelates with cancer diagnostic effects .

HY-W010922

Fmoc-Dap(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-Dap(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bicyclic peptide tachykinin NK2 antagonists .

HY-W000665

2,6-Dimethyl-L-tyrosine Dmt	Opioid Receptor	Neurological Disease
2,6-Dimethyl-L-tyrosine (Dmt) is a tyrosine derivative that enhances receptor affinity, functional bioactivity and in vivo analgesia of opioid peptides .

HY-W013154

Fmoc-Tic-OH	Amino Acid Derivatives	Others
Fmoc-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as the biotinylated derivative of the opioid receptor antagonist TIPP .

HY-W101495

Boc-Leu-OH hydrate N-Boc-L-leucine monohydrate	Amino Acid Derivatives	Others
Boc-Leu-OH hydrate (N-Boc-L-leucine monohydrate) is an amino acid derivative with a Boc protecting group, which can be used to synthesize L-prolyl-L-leucyl-glycinamide peptide, a peptide mimetic with dopamine receptor modulatory activity .

HY-W048739

Fmoc-α-Me-Leu-OH	Amino Acid Derivatives	Others
Fmoc-α-Me-Leu-OH is a leucine derivative with an Fmoc protecting group, which can be used to synthesize peptides with oxytocin receptor agonist activity .

HY-W097054

Fmoc-L-cysteic acid	Amino Acid Derivatives	Others
Fmoc-L-cysteic acid is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize triarylsulfonium compounds for radiolabeling of peptides .

HY-W019032

Fmoc-D-Dab(Boc)-OH	Amino Acid Derivatives	Others
Fmoc-D-Dab(Boc)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize peptides with antibacterial activity .

HY-W008876

Fmoc-Pen(Trt)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Trt)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize the inhibitory cystine knot (ICK) peptide ProTx-II .

HY-W077219

Boc-L-Arg(Mtr)-OH Boc-Arg(Mtr)-OH	Amino Acid Derivatives	Others
Boc-L-Arg(Mtr)-OH (Boc-Arg(Mtr)-OH) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antithrombotic activity .

HY-W101889

Boc-Gln(Xan)-OH N-Boc-N'-xanthyl-L-glutamine	Amino Acid Derivatives	Others
Boc-Gln(Xan)-OH (N-Boc-N'-xanthyl-L-glutamine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize peptides with antigenic activity .

HY-W101305

Fmoc-Pen(Acm)-OH	Amino Acid Derivatives	Others
Fmoc-Pen(Acm)-OH is an amino acid derivative with an Fmoc protecting group that can be used to synthesize chemically modified cyclic peptides containing cell adhesion recognition (CAR) sequences .

HY-W009118

Fmoc-5-Ava-OH	Amino Acid Derivatives	Others
Fmoc-5-Ava-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize fatty acid-based dimeric peptides with PSD-95 inhibitory activity .

HY-W041989

Fmoc-Oic-OH	Amino Acid Derivatives	Others
Fmoc-Oic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

HY-P3625

Dynorphin (2-17), amide (porcine)	Endogenous Metabolite Opioid Receptor	Neurological Disease
Dynorphin (2-17), amide (porcine) is a dynorphin derivative with some analgesic effects. Dynorphin is a class of opioid peptides produced by the precursor protein dynorphinogen and is involved in pain, addiction and mood regulation .

HY-W013153

Fmoc-D-Tic-OH	Amino Acid Derivatives	Others
Fmoc-D-Tic-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as [desArg ¹⁰]HOE 140, which has bradykinin B1 antagonist activity .

HY-34738

Boc-β-Ala-ol 3-(Boc-amino)-1-propanol	Amino Acid Derivatives	Others
Boc-β-Ala-ol (3-(Boc-amino)-1-propanol) is an alanine derivative with a Boc protecting group at the N-terminus, which can be used to synthesize bioactive peptide mimics, such as Nα-Benzoyl-α-azaornithine phenyl ester, which has trypsin inhibitory activity .

HY-Y1636

Fmoc-Arg(Pbf)-OH	Amino Acid Derivatives	Others
Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis) .

HY-Y1169

Fmoc-Asp(OtBu)-OH 4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate; Fmoc-L-Asp(OtBu)-OH	Amino Acid Derivatives	Others
Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis .

HY-W142073

7-Methyl-DL-tryptophan 7-Methyltryptophan	Amino Acid Derivatives	Infection
7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .

HY-W044285

Fmoc-D-4-Aph(cBm)-OH	Amino Acid Derivatives	Others
Fmoc-D-4-Aph(cBm)-OH is an amino acid derivative with an Fmoc protecting group, which can be used to synthesize biologically active peptide mimetics, such as Ac-D2Nal-D4Cpa-D3Pal-Ser-4Aph/4Amf(P)-D4Aph/D4Amf(Q)-Leu-ILys-Pro-DAla-NH2 with gonadotropin-releasing hormone (GnRH) antagonist activity .

HY-P1157

Exendin derivative 1	Peptides	Others
Exendin derivative 1 is a 39 amino acid peptide.

HY-P1229

FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-P1231

GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS	GCGR	Metabolic Disease
GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.

HY-P4118

EB1 peptide Penetrating analog	Peptides	Others
EB1 peptide (Penetrating analog), a Penetratin peptide derivative, is an amphipathic cell-penetrating peptide (CPP). EB1 peptide has the potential for intracellular drug delivery research .

HY-W012906

(S)-2-Allylglycine 1 Publications Verification L-Allylglycine	Peptides	Others
(S)-2-Allylglycine is a peptide derivative.

HY-400312

Cbz-D-Leu-Val-Boc	Biochemical Assay Reagents	Cancer
Cbz-D-Leu-Val-Boc is a peptide derivative.

HY-W008922

Fmoc-D-3,3-diphenylalanine	Amino Acid Derivatives	Others
Fmoc-D-3,3-diphenylalanine is a peptide derivative.

HY-P3877

(Leu31,Pro34)-Peptide YY (human)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

HY-P1223

Exendin-3/4 (59-86)	GCGR	Metabolic Disease
Exendin-3/4 (59-86) is a Exendin-4 peptide derivative.

HY-P3994

[3,5 Diiodo-Tyr7] Peptide T	Amino Acid Derivatives	Others
[3,5 Diiodo-Tyr7] Peptide T is a threonine derivative .

HY-P2218

Anditixafortide	CXCR	Cancer
Anditixafortide (Pentixather) is an endoradiotherapeutic vector. Anditixafortide is a CXCR4-targeting peptide derivative .

HY-41912B

Boc-D-norleucine Boc-D-Nle-OH; N-BOC-D-norleucine	Amino Acid Derivatives	Others
Boc-D-norleucine (Boc-D-Nle-OH) is a leucine derivative that can be used for peptide synthesis .

HY-P2392

Fmoc-Ala-Thr(psi(Me,Me)pro)-OH	Amino Acid Derivatives	Others
Fmoc-Ala-Thr(psi(Me,Me))-OH is an Fmoc protected alanine derivative and can be used for peptide synthesis.

HY-P4762

(TYR34)-PTH (7-34) AMIDE (BOVINE)	Peptides	Others
(TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH) .

HY-W338516

Fmoc-L-Homoarginine hydrochloride	Amino Acid Derivatives	Others
Fmoc-L-Homoarginine hydrochloride is a derivative of amino acid with protecting groups. Fmoc-L-Homoarginine hydrochloride can be used for synthesis of homoarginine containing peptide .

HY-P3877A

(Leu31,Pro34)-Peptide YY (human) (TFA)	Neuropeptide Y Receptor	Neurological Disease
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y₁ agonist with a K_D of 1.0 nM .

HY-W036160

N-Fmoc-O-ethyl-L-homoserine	Amino Acid Derivatives	Others
N-Fmoc-O-ethyl-L-homoserine is an homoserine derivative, can be used in cyclic peptide compounds synthesis, as a reducing reagent .

HY-P2292

Omiganan, FITC labeled	Bacterial Fungal	Infection
Omiganan, FITC labeled is a peptide-FITC complex composed of Omiganan and a FITC. Omiganan is a bactericidal and fungicidal cationic peptide being developed as a topical gel for prevention of catheter-associated infections. FITC is a derivative of fluorescein for the labeling of amines .

HY-P10601

αs1-CN f(143–149)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
αs1-CN f(143–149) is an orally active casein-derived peptide sequence. αs1-CN f(143–149) exhibits angiotensin-converting enzyme (ACE) inhibitory activity (IC₅₀=6.58 μM) and antihypertensive activity .

HY-138106

Fmoc-D-Cit-OH	Amino Acid Derivatives	Others
Fmoc-D-Cit-OH is citrulline with an Fmoc protecting group, which can be used to synthesize bioactive peptide mimetics, such as H-Dmt-D-Cit-Aba-b-Ala-NMe-30,50-(CF3)2-Bn and H-Dmt-D-Cit-Aba-b-Ala-NMe-Bn with neurokinin-1 antagonist activity .

HY-W419374

ivDde-Lys(Fmoc)-OH	Amino Acid Derivatives	Others
ivDde-Lys(Fmoc)-OH is a derivative of amino acid with protecting groups. ivDde-Lys(Fmoc)-OH can be used for peptide synthesis .

HY-W562116

Boc-Lys(ivdde)-OH	Amino Acid Derivatives	Others
Boc-Lys(ivdde)-OH is a derivative of amino acid. Boc-Lys(ivdde)-OH can be used for synthesis of lysine containing peptide .

HY-P10741

DOTA-EB-TATE	Somatostatin Receptor Radionuclide-Drug Conjugates (RDCs)	Cancer
DOTA-EB-TATE is composed of SST peptide derivative, DOTA-octreotate conjugated a common to an Evans blue analog (EB). DOTA-EB-TATE is a peptide drug conjugate (PDC) improves the pharmacokinetics of SSTR2 analogs and reduces PRRT toxicity .

HY-114161

H-Val-Pro-Pro-OH 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH, a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-P5516

SNNF(N-Me)GA(N-Me)IL	Peptides	Others
SNNF(N-Me)GA(N-Me)IL is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)

HY-P5517

SNNF(N-Me)GA(N-Me)ILSS	Peptides	Others
SNNF(N-Me)GA(N-Me)ILSS is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)

HY-114161A

H-Val-Pro-Pro-OH TFA 1 Publications Verification	Angiotensin Receptor	Cardiovascular Disease Metabolic Disease Inflammation/Immunology Endocrinology
H-Val-Pro-Pro-OH (TFA), a milk-derived proline peptides derivative, is an inhibitor of Angiotensin I converting enzyme (ACE), with an IC₅₀ of 9 μM.

HY-W002450

L-Cyclohexylalanine	Peptides	Cardiovascular Disease
L-Cyclohexylalanine is an amino acid derivative. L-Cyclohexylalanine modifies an atrial natriuretic peptide, regulates homeostasis of body fluid and blood pressure homeostasis and vasodilation activity .

HY-W109214

Fmoc-L-Dap(Boc,Me)-OH	Amino Acid Derivatives	Others
Fmoc-L-Dap(Boc,Me)-OH is a derivative of amino acid with protecting groups. Fmoc-L-Dap(Boc,Me)-OH can be used for synthesis of diaminopropionic acid containing peptide .

Cat. No.	Product Name

HY-K0219

High-Affinity Iodoacetyl Agarose
MCE High-Affinity Iodoacetyl Agarose, a 4% highly cross-linked agarose reagent coupled with a derivative of iodoacetic acid, is ideal for conjugating sulfhydryl-containing peptide or protein for subsequent affinity purification.

Cat. No.	Product Name	Chemical Structure

HY-Y1636S1

Fmoc-Arg(Pbf)-OH-13C6
Fmoc-Arg(Pbf)-OH- ¹³C₆ is the ¹³C labeled Fmoc-Arg(Pbf)-OH[1]. Fmoc-Arg(Pbf)-OH is an arginine derivative containing amine protecting group Fmoc. Fmoc-Arg(Pbf)-OH is a building block for the introduction of Arg into SPPS (Solid-Phase Peptide Synthesis)[2].

HY-Y1169S1

Fmoc-Asp(OtBu)-OH-13C4,15N
Fmoc-Asp(OtBu)-OH- ¹³C₄, ¹⁵N is the ¹³C and ¹⁵N labeled Fmoc-Asp(OtBu)-OH[1]. Fmoc-Asp(OtBu)-OH (4-tert-Butyl N-(fluoren-9-ylmethoxycarbonyl)-L-aspartate) is a aspartate derivative containing amine protecting group Fmoc. Fmoc-Asp(OtBu)-OH can be used for peptide synthesis[2].

Cat. No.	Product Name		Classification