Search Result

Pathways Recommended:	Metabolic Enzyme/Protease

Results for "

angiotensin converting enzyme

" in MedChemExpress (MCE) Product Catalog:

By Targets:	Angiotensin Receptor (6) Angiotensin-converting Enzyme (ACE) (179) 11β-HSD (3) Adrenergic Receptor (1) Amino Acid Derivatives (1) Antibiotic (1) Apoptosis (17) Autophagy (3) Bacterial (1) Biochemical Assay Reagents (1) Bradykinin Receptor (1) Casein Kinase (3) Caspase (2) CDK (1) Cholinesterase (ChE) (1) Dopamine Receptor (1) Drug Metabolite (12) Endogenous Metabolite (14) GnRH Receptor (1) HIV (1) Influenza Virus (1) Interleukin Related (2) Isotope-Labeled Compounds (16) mAChR (2) MMP (4) Neprilysin (5) NF-κB (6) Opioid Receptor (1) Parasite (3) Reactive Oxygen Species (1) Renin (2) SARS-CoV (4) Sirtuin (4) STAT (4) TNF Receptor (2) Toll-like Receptor (TLR) (2) Xanthine Oxidase (1)
By Research Areas:	Cancer (33) Cardiovascular Disease (166) Endocrinology (7) Infection (7) Inflammation/Immunology (20) Metabolic Disease (19) Neurological Disease (12)

By Targets:

Angiotensin Receptor (6)

Angiotensin-converting Enzyme (ACE) (179)

11β-HSD (3)

Adrenergic Receptor (1)

Amino Acid Derivatives (1)

Antibiotic (1)

Apoptosis (17)

Autophagy (3)

Bacterial (1)

Biochemical Assay Reagents (1)

Bradykinin Receptor (1)

Casein Kinase (3)

Caspase (2)

CDK (1)

Cholinesterase (ChE) (1)

Dopamine Receptor (1)

Drug Metabolite (12)

Endogenous Metabolite (14)

GnRH Receptor (1)

HIV (1)

Influenza Virus (1)

Interleukin Related (2)

Isotope-Labeled Compounds (16)

mAChR (2)

MMP (4)

Neprilysin (5)

NF-κB (6)

Opioid Receptor (1)

Parasite (3)

Reactive Oxygen Species (1)

Renin (2)

SARS-CoV (4)

Sirtuin (4)

STAT (4)

TNF Receptor (2)

Toll-like Receptor (TLR) (2)

Xanthine Oxidase (1)

By Research Areas:

Cancer (33)

Cardiovascular Disease (166)

Endocrinology (7)

Infection (7)

Inflammation/Immunology (20)

Metabolic Disease (19)

Neurological Disease (12)

222

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

Biochemical Assay Reagents

Peptides

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Targets Recommended: Angiotensin-converting Enzyme (ACE) Angiotensin Receptor NEDD8-activating Enzyme E1/E2/E3 Enzyme IRE1 TET Protein

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-P2983

**Angiotensin-converting enzyme** Kininase II; CD143	Endogenous Metabolite	Cardiovascular Disease Cancer
Angiotensin-converting enzyme (Kininase II) is a dicarboxypeptidase, it converts inactive Angiotensin I (Ang I) to active Ang II and degrades active bradykinin (BK). Angiotensin-converting enzyme is a potent vasoconstrictor, is often used in biochemical studies .

HY-P3141

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN	Angiotensin-converting Enzyme (ACE)	Infection
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN, an angiotensin-converting enzyme 2 (ACE2) related peptide, can be used to study the function of ACE2 .

HY-137875

N-Benzoyl-Gly-His-Leu hydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
N-Benzoyl-Gly-His-Leu hydrate is a leucine derivative, a polypeptide. N-Benzoyl-Gly-His-Leu hydrate exerts function with angiotensin converting enzyme (ACE) substrate.

HY-122032

A 58365A	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-P5913

[Tyr6]-Angiotensin II	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
[Tyr6]-Angiotensin II is a peptide fragment , and can bind to the angiotensin converting enzyme 2 .

HY-123657

RXP 407	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
RXP 407 is a potent and selective Angiotensin-converting Enzyme (ACE) inhibitor with a K_i of 12nM .

HY-P2072

GF109	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
GF109 is a potent parenteral inhibitor of angiotensin converting enzyme (ACE). GF109 has antihypertensive effects .

HY-113813

SQ 28853	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
SQ 28853 is an angiotensin converting enzyme (ACE) inhibitor with potent diuretic activity. SQ 28853 can be used for the research of cardiovascular .

HY-P4560

H-Pro-Phe-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
H-Pro-Phe-OH is a dipeptide containing proline and phenylalanine, which can serve as a substrate for prolinase. H-Pro-Phe-OH can also be used for polypeptide synthesis, where phenylalanine is an aromatic amino acid that can inhibit the activity of **Angiotensin-converting enzyme (ACE**, HY-P2983) .

HY-139801

Indolapril hydrochloride CI-907	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Indolapril hydrochloride (CI-907) is an orally active nonsulfhydryl angiotensin converting enzyme (ACE) inhibitor. Indolapril hydrochloride is highly specific in suppressing the contractile or pressor responses to Angiotensin I. Indolapril hydrochloride is a potent antihypertensive agent .

HY-163438

BKIDC-1553	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
BKIDC-1553 is an orally active antiglycolytic agent and a bumped kinase inhibitor derived compound with a predicted ~17 h half-life in human. BKIDC-1553 inhibits CYP2C8 and **Angiotensin Converting Enzyme** and can be used for cancer research .

HY-N0214

Peimisine 2 Publications Verification Ebeiensine	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Inflammation/Immunology Cancer
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Inflammation/Immunology Cancer
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N12763

Sodium new houttuyfonate SNH	Bacterial Renin	Inflammation/Immunology
Sodium new houttuyfonate (SNH) is a partially reversible NDM-1 inhibitor with an IC₅₀ of 14.2 μM. Sodium new houttuyfonate is an inhibitor against renin and angiotensin I converting enzyme (ACE). Sodium new houttuyfonate can recover the antibacterial activity of Meropenem (HY-13678) against E. coli BL21/pET15b-blaNDM-1 .

HY-113535

Foroxymithine	Biochemical Assay Reagents	Others
Foroxymithine is an inhibitor of angiotensin converting enzyme.

HY-P1032

Angiotensin I (human, mouse, rat) 1 Publications Verification	Endogenous Metabolite	Others
Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the angiotensin-converting enzyme (ACE).

HY-101681

Utibapril FPL 63547	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Utibapril is an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activities.

HY-U00041

Pivalopril 1 Publications Verification Pivopril; RHC 3659(S)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Pivalopril is a new orally active angiotensin converting enzyme (ACE) inhibitor.

HY-108321

Zofenopril	Angiotensin-converting Enzyme (ACE)	Neurological Disease
Zofenopril is an **angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀** of 81 μM.

HY-113681

REV 5975	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
REV 5975 is a angiotensin converting enzyme (ACE) inhibitor. REV 5975 shows a partial reduction of the angiotensin I effect .

HY-107337

Delapril hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases .

HY-P1032F

Biotinyl-Angiotensin I (human, mouse, rat)	Endogenous Metabolite	Endocrinology
Biotinyl-Angiotensin I (human, mouse, rat) is biotin-labeled Angiotensin I . Angiotensin I (human, mouse, rat) is the precursor to the vasoconstrictor peptide angiotensin II, cleaved by the **angiotensin-converting enzyme** (ACE) .

HY-U00074

Rentiapril racemate SA-446 racemate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril racemate (SA-446 racemate) is the racemate of Rentiapril. Rentiapril is an **angiotensin converting enzyme (ACE**) inhibitor.

HY-B0279

Ramipril 2 Publications Verification HOE-498	Angiotensin-converting Enzyme (ACE) Apoptosis	Cardiovascular Disease Cancer
Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-P0143

Leucylarginylproline	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Leucylarginylproline is an angiotensin-converting enzyme (ACE) inhibitor with an IC₅₀ of 0.27μM.

HY-P4471

p-Hydroxyhippuryl-His-Leu	Angiotensin-converting Enzyme (ACE)	Others
p-Hydroxyhippuryl-His-Leu is a peptide substrate of angiotensin-converting enzyme (ACE) .

HY-B0093

Benazepril	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Benazepril, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.

HY-B0093A

Benazepril hydrochloride CGS14824A	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Benazepril hydrochloride, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.

HY-B0331A

Enalapril maleate 5+ Cited Publications MK-421 maleate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Cancer
Enalapril (MK-421) maleate, the active metabolite of enalapril, is an angiotensin-converting enzyme (ACE) inhibitor.

HY-A0043

Cilazapril Ro 31-2848	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-A0043A

Cilazapril monohydrate 1 Publications Verification Ro 31-2848 monohydrate	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril Monohydrate is a angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-106446

Rentiapril SA-446	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Rentiapril is an orally active angiotensin converting enzyme (ACE) inhibitor with antihypertensive activity .

HY-A0043B

Cilazapril hydrochloride Ro 31-2848 hydrochloride	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Cilazapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor used for the treatment of hypertension and congestive heart failure.

HY-P4546

Abz-Ser-Pro-3-nitro-Tyr	Angiotensin-converting Enzyme (ACE)	Others
Abz-Ser-Pro-3-nitro-Tyr is the substrate of ACE2 (angiotensin-converting enzyme-2) .

HY-P1444

Acein	Dopamine Receptor	Neurological Disease
Acein is a novel nonapeptide, H-Pro-Pro-Thr-Thr-Thr-Lys-Phe-Ala-Ala-OH. Acein can promote the release of dopamine. Acein targets angiotensin converting enzyme (ACE I). Angiotensin converting enzyme (ACE I) can be used in nervous system related research .

HY-B0477

Quinapril hydrochloride CI-906	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Quinapril (hydrochloride) (CI-906) is a proagent that belongs to the angiotensin-converting enzyme (ACE) inhibitor class of medications.

HY-B0331AS

Enalapril D5 maleate MK-421-d₅(maleate)	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-116023

Moveltipril Moveltipril calcium; MC-838	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Moveltipril (Moveltipril calcium; MC-838) is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-P2366

Teprotide SQ-20881	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease Metabolic Disease
Teprotide is an inhibitor of angiotensin-converting enzyme (ACE) inhibitor. Teprotide can be used to study hypertensive .

HY-119025

L 681176	Others	Cardiovascular Disease
L 681176 is an angiotensin-converting enzyme inhibitor that can be isolated from STREPTOMYCES sp. MA 5143a .

HY-P1829

Angiotensin I/II (1-6)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II 1-6 contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1829A

Angiotensin I/II (1-6) (TFA)	Angiotensin Receptor	Cardiovascular Disease
Angiotensin I/II (1-6) TFA contains the amino acids 1-6 and is converted from Angiotensin I/II peptide. The precursor angiotensinogen is cleaved by renin to form angiotensin I. Angiotensin I ishydrolyzed by angiotensin-converting enzyme (ACE) to form the biologically active angiotensin II. Angiotensin II has been investigated for the treatment, basic science, and diagnostic of Hypertension, Renin Angiotensin System, and Idiopathic Membranous Nephropathy .

HY-P1488

Bradykinin (1-5)	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Bradykinin (1-5) is a major stable metabolite of Bradykinin, formed by the proteolytic action of angiotensin-converting enzyme (ACE).

HY-107318

Alacepril Cetapril; DU-1219	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Alacepril (Cetapril) is an orally active angiotensin converting enzyme (ACE) inhibitor with long lasting antihypertensive effect .

HY-106816

Ceronapril Ceranapril; SQ 29852	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Ceronapril (SQ 29852) is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ of 36 nM .

HY-P4552

Hippuryl-Phe-Arg-OH	Angiotensin-converting Enzyme (ACE)	Others
Hippuryl-Phe-Arg-OH is the active site on the cell surface of Angiotensin I converting enzyme (ACE) .

HY-19022

BW A256C	Others	Cardiovascular Disease Others Metabolic Disease
Palatrigine is a compound with angiotensin-converting enzyme inhibitory and beta-adrenergic receptor blocking properties .

HY-126826

Antibiotic K 4	Antibiotic Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Antibiotic K 4 is an inhibitor of angiotensin I converting enzyme (ACE) (K_i: 0.18 μM). Antibiotic K 4 inhibits pressor response to angiotensin I in rats .

HY-P1044

Spinorphin LVV-hemorphin-4	Others	Neurological Disease
Spinorphin is an inhibitor of enkephalin-degrading enzymes. Spinorphin inhibits aminopeptidase, dipeptidyl aminopeptidase III, angiotensin-converting enzyme and enkephalinase. Spinorphin possesses an antinociceptive effect .

HY-101577

NCX899	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
NCX899 is a NO-releasing derivative of enalapril, and shows inhibitory activity against angiotensin-converting enzyme (ACE) activity.

Cat. No.	Product Name

HY-L052

Anti-COVID-19 Compound Library

1,470 compounds

COVID-19 poses a serious threat to people's health, and it is urgent to develop drugs to treat COVID-19 quickly. The screening of anti-COVID-19 drugs by using the clinical and approved compounds can greatly shorten the research and development cycle. In addition, the virtual screening technology can effectively narrow the scope of screening and improve the screening efficiency in the pre-screening of new drugs.

Taking advantage of our virtual screening, we conduct virtual screening of approved compound library and clinical compound library based on the 3CL protease (PDB ID: 6LU7), Spike Glycoprotein (PDB ID: 6VSB), NSP15 (PDB ID: 6VWW), RDRP, PLPro and ACE2 (Angiotensin Converting Enzyme 2) structure. We design a unique collection of 1,470 compounds which may have anti-COVID-19 activity. Anti-COVID-19 Compound Library will be a powerful tool for screening new anti-COVID-19 activity drugs.

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-N0214

Peimisine 2 Publications Verification Ebeiensine	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Plants Inflammation/Immunology Disease Research Fields Fritillaria cirrhosa	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-B0093

Benazepril	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Benazepril, an angiotensin converting enzyme inhibitor, which is a medication used to treat high blood pressure.

HY-18206

Lisinopril 4 Publications Verification MK-521	Cardiovascular Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-125112

Vicenin-1	Cardiovascular Disease Flavonoids Classification of Application Fields Flavones Leguminosae Source classification Phenols Polyphenols Plants Disease Research Fields Trigonella foenum-graecum Linn.	Angiotensin-converting Enzyme (ACE)
Vicenin 1 is a C-glycosylflavone that has an inhibitory effect on angiotensin-converting enzyme (ACE)(IC₅₀=52.50 μM) .

HY-N9528

Lyciumin A	Cardiovascular Disease Alkaloids Monophenols Pyrrole Alkaloids Classification of Application Fields Source classification Phenols Plants Solanaceae Lycium chinense Miller Disease Research Fields Indole Alkaloids	Angiotensin-converting Enzyme (ACE) Renin
Lyciumin A, a cyclic octapeptide, exhibits inhibitory activity on proteases, renin and angiotensin-converting enzyme. Lyciumin A can be used for the research of hypertension .

HY-A0116A

Trandolaprilate hydrate Trandolaprilat hydrate; RU 44403 hydrate	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate hydrate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate hydrate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-122032

A 58365A	Structural Classification Alkaloids Microorganisms Pyrrole Alkaloids Source classification	Angiotensin-converting Enzyme (ACE)
A 58365A is a potent angiotensin converting enzyme (ACE) inhibitor .

HY-N0214A

Peimisine hydrochloride Ebeiensine hydrochloride	Alkaloids Piperidine Alkaloids Structural Classification Liliaceae Classification of Application Fields Source classification Fritillaria ussuriensis Maxim. Plants Inflammation/Immunology Disease Research Fields	mAChR Angiotensin-converting Enzyme (ACE) Apoptosis
Peimisine (Ebeiensine) hydrochloride is a muscarinic M receptor antagonist and **angiotensin converting enzyme** (ACE) inhibitor. Peimisine hydrochloride shows anti-tumor, anti-inflammatory, antihypertensive activities. Peimisine can induce apoptosis and be used in cough and asthma research .

HY-N12763

Sodium new houttuyfonate SNH	Structural Classification Natural Products Saururaceae Houttuynia cordata Thunb. Source classification Plants	Bacterial Renin
Sodium new houttuyfonate (SNH) is a partially reversible NDM-1 inhibitor with an IC₅₀ of 14.2 μM. Sodium new houttuyfonate is an inhibitor against renin and angiotensin I converting enzyme (ACE). Sodium new houttuyfonate can recover the antibacterial activity of Meropenem (HY-13678) against E. coli BL21/pET15b-blaNDM-1 .

HY-N9314

Camellianin B	Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Metabolic Disease Plants Disease Research Fields Theaceae	Angiotensin-converting Enzyme (ACE)
Camellianin B, a flavonoid compound, is a Camellianin A metabolite. Camellianin B has antioxidant and angiotensin converting enzyme (ACE) inhibitory activities .

HY-A0116

Trandolaprilate Trandolaprilat; RU 44403	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate is a potent **angiotensin-converting enzyme (ACE*) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos* induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-N4090

Vicenin 3	Cardiovascular Disease Structural Classification Classification of Application Fields Flavones Source classification Plants Desmodium styracifolium (Osbeck.) Merr. Flavonoids other families Leguminosae Phenols Polyphenols Disease Research Fields	Angiotensin-converting Enzyme (ACE)
Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-N2021

Phosphoramidon	Structural Classification Microorganisms Ketones, Aldehydes, Acids	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-N2021A

Phosphoramidon Disodium	Cardiovascular Disease Alkaloids Structural Classification Microorganisms Classification of Application Fields Source classification Disease Research Fields Indole Alkaloids Cancer	MMP Angiotensin-converting Enzyme (ACE) Neprilysin Endogenous Metabolite
Phosphoramidon Disodium, a microbial metabolite, is a specific metalloprotease thermolysin inhibitor with an IC₅₀ of 0.4 μg/mL. Phosphoramidon Disodium also inhibits endothelin-converting enzyme (ECE), neutral endopeptidase (NEP), and angiotensin-converting enzyme (ACE) with IC₅₀ values of 3.5, 0.034, and 78 μM, respectively .

HY-N10860

5-O-beta-D-Glucopyranosylmyricanol	Structural Classification Other Monoterpenes Terpenoids Source classification Morella esculenta (Buch.-Ham. ex D. Don) I. M. Turner Plants Myricaceae	Others
5-O-beta-D-Glucopyranosylmyricanol is a diarylheptane compound isolated from Myrica esculenta that has a weak inhibitory effect on angiotensin-converting enzyme (ACE) .

HY-107339

Deserpidine Harmonyl	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

HY-A0116R

Trandolaprilate (Standard)	Structural Classification Alkaloids Pyrrole Alkaloids Source classification Endogenous metabolite	Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Trandolaprilate (Standard) is the analytical standard of Trandolaprilate. This product is intended for research and analytical applications. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity .

HY-N1102

Vasicinol 6-Hydroxypeganine	Malvaceae Structural Classification Alkaloids Other Alkaloids Source classification Plants	Angiotensin-converting Enzyme (ACE)
Vasicinol is a reversible inhibitor of sucrase (IC₅₀: 250 μM). Vasicinol is a HbF inducer. Vasicinol also inhibits Angiotensin-converting Enzyme (ACE). Vasicinol is apyrroquinazoline alkaloid that can be isolated from Adhatoda vasica .

HY-N3470

Isomartynoside	Structural Classification Natural Products Source classification Populus tomentosa Plants Salicaceae	Angiotensin-converting Enzyme (ACE)
Isomartynoside is a potent angiotensin converting enzyme (ACE) inhibitor with an IC₅₀ value of 505.9 µM. Isomartynoside is a phenylpropanoid glycoside that can be found in Galeopsis pubescens . IC₅₀: 505.9 µM (ACE)

HY-A0115

Ramiprilat HOE 498 diacid; Ramipril diacid	Cardiovascular Disease Structural Classification Alkaloids Pyrrole Alkaloids Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields	Drug Metabolite Angiotensin-converting Enzyme (ACE) Endogenous Metabolite
Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-130199

Psoromic acid Parellic acid	Structural Classification Microorganisms Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Disease Research Fields	Others
Psoromic acid is a potent and selective RabGGTase (Rab geranylgeranyl transferase) inhibitor with an IC₅₀ value of 1.3 µM. Psoromic acid is an antioxidative agent. Psoromic acid exhibits a competitive type of HMGR inhibition and mixed type of ACE (angiotensin converting enzyme) inhibition .

HY-N11970

Isocrenatoside	Structural Classification Labiatae Source classification Phenols Polyphenols Plants Achillea atrata L.	Angiotensin-converting Enzyme (ACE)
Isocrenatoside (compound 6) is a cyclic octapeptide and an inhibitor of angiotensin-converting enzyme (ACE). Isocrenatoside is isolated from the ethanolic extract of Microtoena prainiana stems. Studies have found that the inhibitory efficiency of 1 mg/mL Isocrenatoside can reach 99.3% .

HY-N2165R

Vicenin 2 (Standard)	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Leguminosae Source classification Phenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2 (Standard) is the analytical standard of Vicenin 2. This product is intended for research and analytical applications. Vicenin 2 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=43.83 μM) from the aerial parts of Desmodium styracifolium .

HY-N4090R

Vicenin 3 (Standard)	Structural Classification Flavonoids other families Flavones Leguminosae Source classification Phenols Polyphenols Plants Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 3 (Standard) is the analytical standard of Vicenin 3. This product is intended for research and analytical applications. Vicenin 3 is an angiotensin-converting enzyme (ACE) inhibitor (IC₅₀=46.91 μM) from the aerial parts of Desmodium styracifolium .

HY-107339R

Deserpidine (Standard)	Apocynaceae Alkaloids Piperidine Alkaloids Structural Classification Plants Rauwolfia canescens Indole Alkaloids	Angiotensin-converting Enzyme (ACE)
Deserpidine (Standard) is the analytical standard of Deserpidine. This product is intended for research and analytical applications. Deserpidine (Harmonyl) is an alkaloid isolated from the root of Rauwolfia canescens related to Reserpine. Deserpidine is used as an antihypertensive agent and a tranquilizer. Deserpidine is a competitive angiotensin converting enzyme (ACE) inhibitor. Deserpidine also decreases angiotensin II-induced aldosterone secretion by the adrenal cortex .

HY-N2165

Vicenin 2 2 Publications Verification	Cardiovascular Disease Structural Classification Flavonoids Classification of Application Fields Flavones Leguminosae Phenols Polyphenols Plants Disease Research Fields Desmodium styracifolium (Osbeck.) Merr.	Angiotensin-converting Enzyme (ACE)
Vicenin 2, a flavonoid, is an orally active angiotensin-converting enzyme (ACE) inhibitor (IC₅₀ of 43.83 μM) . Vicenin 2 has radioprotective, anti-nociceptive effects, anti-glycation anti-inflammatory, antioxidant, anticancer, antiangiogenic properties .

HY-B0130

Perindopril 5 Publications Verification S-9490	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Angiotensin-converting Enzyme (ACE) NF-κB STAT Sirtuin
Perindopril erbumine is an **angiotensin-converting enzyme** inhibitor. Perindopril erbumine modulates NFκB and STAT3 signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-119195

I5B2	Structural Classification Microorganisms Source classification Phenols Polyphenols	Angiotensin-converting Enzyme (ACE)
I5B2 is an angiotensin I converting enzyme inhibitor (IC₅₀=0.091 μM) that can be isolated from the culture medium of Actinomycete actininadura sp. No. 937ZE-1. I5B2 can be used in the study of hypertension .

HY-N7450

Icariside D2	Infection Structural Classification Natural Products Classification of Application Fields Source classification Plants Annonaceae Inflammation/Immunology Disease Research Fields Annona glabra Linn.	Angiotensin-converting Enzyme (ACE) Apoptosis HIV
Icariside D2, isolated from Annona glabra fruit, inhibits **angiotensin-converting enzyme. Icariside D2 shows significant cytotoxic activity on the HL-60 cell line with the IC₅₀** value of 9.0 ± 1.0 μM. Icariside D2 induces apoptosis .

HY-N2298

Camellianin A	Structural Classification Adinandra nitida Merr. ex Li Flavonoids Classification of Application Fields Flavones Source classification Phenols Polyphenols Plants Disease Research Fields Theaceae Cancer	Apoptosis
Camellianin A, the main flavonoid in A. nitida leaves, displays anticancer activity and angiotensin converting enzyme (ACE)-inhibitory activity. Camellianin A inhibits the proliferation of the human Hep G2 and MCF-7 cell lines and induces the significant increase of the G0/G1 cell population .

HY-N2533

Cyanidin 3-sambubioside chloride Cyanidin-3-O-sambubioside chloride	Infection Structural Classification Anthocyans Flavonoids other families Classification of Application Fields Source classification Phenols Polyphenols Plants Inflammation/Immunology Disease Research Fields	Influenza Virus Angiotensin-converting Enzyme (ACE)
Cyanidin 3-sambubioside chloride (Cyanidin-3-O-sambubioside chloride), a major anthocyanin, a natural colorant, and is a potent NO inhibitor. Cyanidin 3-sambubioside chloride is a H274Y mutation inhibitor, and inhibits influenza neuraminidase activity with an IC₅₀ of 72 μM. Cyanidin 3-sambubioside chloride inhibits angiotensin-converting enzyme (ACE) activity and has antioxidant, anti-angiogenic and antiviral properties .

HY-14393

Emodin Maximum Cited Publications 22 Publications Verification Frangula emodin	Structural Classification Classification of Application Fields Polygonaceae Source classification Plants Endogenous metabolite Quinones Human Gut Microbiota Metabolites Microorganisms Rheum palmatum L. Anthraquinones Phenols Polyphenols Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

HY-14393R

Emodin (Standard) Frangula emodin (Standard)	Quinones Structural Classification Rheum palmatum L. Classification of Application Fields Polygonaceae Source classification Phenols Plants Disease Research Fields Cancer	SARS-CoV Casein Kinase Autophagy 11β-HSD
Emodin (Standard) is the analytical standard of Emodin. This product is intended for research and analytical applications. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction . Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects . Emodin is a potent selective 11β-HSD1 inhibitor with the IC₅₀ of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice .

Species:	Human (8) Rhesus Macaque (2) Rat (1) Mouse (2) Cynomolgus (1)
Tag:	His (9) Avi (3) Fc (7)
Source:	HEK293 (13) Sf9 insect cells (2)

Cat. No.	Compare	Product Name	Species	Source

HY-P72029

	ACE2 Protein, Macaca fascicularis (HEK293, hFc) ACE2; angiotensin-converting enzyme	Cynomolgus	HEK293
	ACE2, Macaca fascicularis (HEK 293, hFc) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2, Macaca fascicularis is also an essential regulator of cardiac function and blood pressure control.

HY-P7828

	ACE2 Protein, Rhesus macaque (HEK293, His) rRhangiotensin-converting enzyme/ACE-2, His; angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Rhesus Macaque	HEK293
	ACE2 Protein, Rhesus macaque (HEK 293, His) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Rhesus macaque is also an essential regulator of cardiac function and blood pressure control.

HY-P7443

	ACE2 Protein, Human (HEK293, mFc) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, mFc) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7441

	ACE2 Protein, Human (HEK293, His, solution) 2 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (HEK293, His, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P7442

	ACE2 Protein, Human (HEK293, hFc, solution) 1 Publications Verification angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human, (HEK293, Fc, solution) is a SARS-CoV-2 receptor. Angiotensin-Converting Enzyme 2 efficiently hydrolyses the potent vasoconstrictor angiotensin II to angiotensin. It is a consequence of this action that ACE2 participates in the renin-angiotensin system.

HY-P70769

	ACE2 Protein, Human (Biotinylated, HEK293, His-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	ACE2 Protein, Human (Biotinylated, HEK 293, His-Avi) is a metallopeptidase which binds effectively to the S1 domain of the SARS‐CoV protein. ACE2 Protein, Human is also an essential regulator of cardiac function and blood pressure control.

HY-P73489

	ACE2 Protein, Human (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (HEK293, His) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag.

HY-P72808

	ACE2 Protein, Human (sf9, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (sf9, His) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

HY-P700445

	ACE2 Protein, Paguma larvata (HEK293, hFc) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Others	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system, converting angiotensin I to anti-hypertrophic angiotensin 1-9 and vasoconstrictor angiotensin II to vasodilator angiotensin 1-7, thereby regulating cardiovascular homeostasis. It can remove the C-terminal residues of vasoactive peptides and cleave a variety of biological peptides. ACE2 Protein, Paguma larvata (HEK293, hFc) is the recombinant ACE2 protein, expressed by HEK293 , with C-hFc labeled tag. The total length of ACE2 Protein, Paguma larvata (HEK293, hFc) is 723 a.a., with molecular weight of 112.7 kDa.

HY-P700455

	ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) angiotensin-converting enzyme 2; ACE-Related Carboxypeptidase; angiotensin-converting enzyme Homolog; ACEH; Metalloprotease MPROT15; ACE2	Human	HEK293
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, HEK293, mFc-Avi) is the recombinant human-derived ACE2 protein, expressed by HEK293 , with C-Avi, C-mFc labeled tag.

HY-P72809

	ACE2 Protein, Rat (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rat	HEK293
	ACE2 is an important carboxypeptidase in the renin-angiotensin system that complexly regulates cardiovascular homeostasis. It specifically converts angiotensin I to angiotensin 1-9 and angiotensin II to angiotensin 1-7, exerting antihypertrophic and vasodilatory effects. ACE2 Protein, Rat (HEK293, His) is the recombinant rat-derived ACE2 protein, expressed by HEK293 , with C-His labeled tag. The total length of ACE2 Protein, Rat (HEK293, His) is 723 a.a., with molecular weight of 105-120 kDa.

HY-P74434

	ACE2 Protein, Mouse (HEK293, His) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293

HY-P72810

	ACE2 Protein, Rhesus Macaque (HEK293, Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Rhesus Macaque	HEK293
	ACE2 Protein, an indispensable counter-regulatory carboxypeptidase within the renin-angiotensin hormone system, plays a pivotal role in maintaining cardiovascular homeostasis by intricately regulating blood volume and systemic vascular resistance. ACE2 exhibits broad enzymatic activity, cleaving various vasoactive peptides such as neurotensin, kinetensin, and des-Arg bradykinin. Moreover, ACE2 is proficient in cleaving other biological peptides, including apelins, casomorphins, and dynorphin A. ACE2 Protein, Rhesus Macaque (HEK293, Fc) is the recombinant Rhesus Macaque-derived ACE2 protein, expressed by HEK293 , with C-hFc labeled tag.

HY-P74433

	ACE2 Protein, Mouse (HEK293, His-Fc) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Mouse	HEK293
	ACE2 protein is an important carboxypeptidase in the renin-angiotensin system, which can regulate blood volume and vascular resistance and maintain cardiovascular homeostasis. It converts angiotensin I to the antihypertrophic angiotensin 1-9 and angiotensin II to the vasodilatory angiotensin 1-7, thereby opposing vasoconstriction. ACE2 Protein, Mouse (HEK293, His-Fc) is the recombinant mouse-derived ACE2 protein, expressed by HEK293 , with C-hFc, C-His, C-8*His labeled tag. The total length of ACE2 Protein, Mouse (HEK293, His-Fc) is 723 a.a., with molecular weight of ~130 kDa.

HY-P72807

	ACE2 Protein, Human (Biotinylated, sf9, His-Avi) angiotensin-converting enzyme 2; ACE-2; ACEH; ACE-related carboxypeptidase	Human	Sf9 insect cells
	The ACE2 protein is an important regulator of blood volume and cardiovascular homeostasis. ACE2 Protein, Human (Biotinylated, sf9, His-Avi) is the recombinant human-derived ACE2 protein, expressed by Sf9 insect cells , with C-Avi, C-His labeled tag.

Compare Products


Products	In-stock - + Add to Cart
Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample	Yes No
Size	* This product has been "discontinued". Optimized version of product available: / In-stock - + Add to Cart Get quote

Cat. No.	Product Name	Chemical Structure

HY-B0331AS

Enalapril D5 maleate
Enalapril-d₅ (maleate) is deuterium labeled Enalapril, which is an angiotensin converting enzyme (ACE) inhibitor.

HY-B0231BS

Enalaprilat-d5 sodium
Enalaprilat-d₅ (sodium) is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-B0231AS

Enalaprilat-d5
Enalaprilat-d₅ is the deuterium labeled Enalaprilat(MK-422), which is an angiotensin-converting enzyme (ACE) inhibitor.

HY-108321S

Zofenopril-d5
Zofenopril-d₅ is deuterium labeled Zofenopril. Zofenopril is an angiotensin-converting enzyme (ACE) inhibitor with an IC50 of 81 μM.

HY-B0279S

Ramipril-d5
Ramipril-d₅ is the deuterium labeled Ramipril. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-P1032S2

Angiotensin I-13C6,15N (human, mouse, rat) TFA
Angiotensin I-13C6,15N (human, mouse, rat) TFA is ¹³C and ¹⁵N labeled Angiotensin I (human, mouse, rat) TFA. Angiotensin I-13C6,15N (human, mouse, rat) TFA is a precursor of angiotensin II and is cleaved into angiotensin II by angiotensin converting enzyme (ACE) .

HY-A0116S

Trandolaprilate-d5
Trandolaprilate-d₅ is a deuterium labeled Trandolaprilate (Trandolaprilat). Trandolaprilate is an angiotensin-converting enzyme (ACE) inhibitor[1].

HY-107337S

Delapril-d3 hydrochloride
Delapril-d₃ (hydrochloride) is the deuterium labeled Delapril hydrochloride. Delapril hydrochloride is an angiotensin-converting enzyme (ACE) inhibitor for the treatment of cardiovascular diseases[1].

HY-B0279S1

Ramipril-d3
Ramipril-d₃ is the deuterium labeled Ramipril[1]. Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC50 of 5 nM.

HY-B0279S2

Ramipril-d4
Ramipril-d₄ is deuterated labeled Ramipril (HY-B0279). Ramipril (HOE-498) is an angiotensin-converting enzyme (ACE) inhibitor with IC₅₀ of 5 nM.

HY-18206S

Lisinopril-d5
Lisinopril-d₅ is the deuterium labeled Lisinopril. Lisinopril (MK-521) is angiotensin-converting enzyme inhibitor, used in treatment of hypertension, congestive heart failure, and heart attacks.

HY-B0592S

Trandolapril-d5
Trandolapril-d₅ is a deuterium labeled Trandolapril (RU44570). Trandolapril is an orally active angiotensin converting enzyme (ACE) inhibitor for hypertension and congestive heart failure (CHF)[1].

HY-A0116S1

Trandolaprilate-d6
Trandolaprilate-d₆ is the deuterium labeled Trandolaprilate[1]. Trandolaprilate is a potent angiotensin-converting enzyme (ACE) inhibitor. Trandolaprilate partially inhibits angiotensin-I-mediated c-fos induction. Trandolaprilate is main bioactive metabolite of Trandolapril. Trandolaprilate shows high lipophilicity[2][3].

HY-109592S

Imidaprilate-d5
Imidaprilate-d₅ is deuterium labeled Imidaprilate. Imidaprilate is an active metabolite of TA-6366, acts as a potent angiotensin converting enzyme (ACE) inhibitor, with an IC50 of 2.6 nM, and is used in the research of hypertensive disease.

HY-117281S

Moexipril-d5
Moexipril-d₅ is the deuterium labeled Moexipril. Moexipril hydrochloride is a potent orally active non-sulfhydryl angiotensin converting enzyme(ACE) inhibitor, which is used for the treatment of hypertension and congestive heart failure[1][2].

HY-B1451S

Imidapril-d3 hydrochloride
Imidapril-d₃ (hydrochloride) (TA-6366-d3) is the deuterium labeled Imidapril hydrochloride. Imidapril hydrochloride (TA-6366) is the hydrochloride salt of Imidapril, an angiotensin-converting enzyme (ACE) inhibitor with antihypertensive activity[1][2].

HY-117281S1

Moexipril-d3
Moexipril-d₃ is deuterated labeled Moexipril (HY-117281). Moexipril is an orally active inhibitor of **angiotensin-converting enzyme (ACE**), and becomes effective by being hydrolyzed to moexiprila hydrochloride. Moexipril exhibits antihypertensive and neuroprotective effects ^- .

HY-100713S

Temocapril-d5
Temocapril-d₅ is the deuterium labeled Temocapril. Temocapril is an angiotensin-converting enzyme (ACE) inhibitor. Temocapril hydrochloride can be used for the research of hypertension, congestive heart failure, acute myocardial infarction, insulin resistance, and renal diseases[1][2].

HY-B1433S

Perindoprilat-d3 disodium
Perindoprilat-d₃ disodium is deuterated labeled Perindoprilat (HY-B1433). Perindoprilat (S 9780) is an angiotensin-converting enzyme (ACE) inhibitor with the IC₅₀ value ranging from 1.5 to 3.2 nM. Perindoprilat can be used in hypertension research .

HY-A0115S1

Ramiprilat-d5
Ramiprilat-d₅ is deuterium labeled Ramiprilat. Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research[1].

HY-A0115S2

Ramiprilat-d4 hydrochloride
Ramiprilat-d₄ hydrochloride is deuterated labeled Ramiprilat (HY-A0115). Ramiprilat (HOE 498 diacid), an active metabolite of Ramipril, is a potent and orally active angiotensin converting enzyme (ACE) inhibitor with a Ki value of 7 pM. Ramiprilat can be used for high blood pressure and heart failure research .

HY-B0130AS

Perindopril-d3 erbumine
Perindopril-d₃ (erbumine) is deuterated labeled Perindopril (erbumine) (HY-B0130A). Perindopril erbumine is an **angiotensin-converting enzyme inhibitor. Perindopril erbumine modulates NF-κB and STAT3** signaling and inhibits glial activation and neuroinflammation. Perindopril erbumine can be used for the research of Chronic Kidney Disease and high blood pressure .

HY-B0368S

Captopril-d3
Captopril-d₃ is deuterium labeled Captopril. Captopril (SQ 14225), antihypertensive agent, is a thiol-containing competitive, orally active angiotensin-converting enzyme (ACE) inhibitor (IC50=0.025 μM) and has been widely used for research of hypertension and congestive heart failure. Captopril is also a New Delhi metallo-β-lactamase-1 (NDM-1) inhibitor with an IC50 of 7.9 μM[1][2][3].

HY-14393S

Emodin-d4

Emodin-d₄ is the deuterium labeled Emodin. Emodin (Frangula emodin), an anthraquinone derivative, is an anti-SARS-CoV compound. Emodin blocks the SARS coronavirus spike protein and angiotensin-converting enzyme 2 (ACE2) interaction[1]. Emodin inhibits casein kinase-2 (CK2). Anti-inflammatory and anticancer effects[2]. Emodin is a potent selective 11β-HSD1 inhibitor with the IC50 of 186 and 86 nM for human and mouse 11β-HSD1, respectively. Emodin ameliorates metabolic disorder in diet-induced obese mice[3].

Cat. No.	Compare	Product Name	Application	Reactivity

HY-P80003

	ACE2 Antibody ACE-2; ACE 2; angiotensin converting enzyme 2; ACE related carboxypeptidase; ACEH; angiotensin converting enzyme homolog; angiotensin converting enzyme like protein; angiotensin I converting enzyme (peptidyl dipeptidase A) 2; angiotensin I converting enzyme 2; DKFZP434A014; EC 3.4.17; angiotensin-converting enzyme 2 precursor; ACE2_HUMAN; angiotensin-converting enzyme 2; ACE-related carboxypeptidase; angiotensin-converting enzyme homolog; Metalloprotease MPROT15; Processed angiotensin-converting enzyme 2.	WB, ICC/IF, IHC-P, IP	Human, Mouse, Hamster
	ACE2 Antibody is a non-conjugated and Rabbit origined monoclonal antibody about 92 kDa, targeting to ACE2. It can be used for WB,ICC,IHC-P,IP assays with tag free, in the background of Human, Mouse, Hamster.

HY-P81084

	ACE Antibody angiotensin converting enzyme 1; ACE; ACE-T; angiotensin-converting enzyme isoform 1precursor; Dipeptidyl carboxy peptidase 1; Kininase II; ACE-1; testis-specific isoform precursor. ACE 1; ACE T; ACE1; angiotensin converting enzyme somatic isoform; angiotensin converting enzyme testis specific isoform; angiotensin I converting enzyme; angiotensin I converting enzyme 1; angiotensin I converting enzyme peptidyl dipeptidase A 1; Carboxycathepsin; CD 143; CD143; CD143 antigen; DCP 1; DCP; DCP1; Dipeptidyl carboxypeptidase 1; MVCD3; Peptidase P; Peptidyl dipeptidase A; Testicular ECA; ACE_HUMAN.	WB, IHC-P, FC	Human, Mouse
	ACE Antibody is an unconjugated, approximately 150 kDa, rabbit-derived, anti-ACE monoclonal antibody. ACE Antibody can be used for: WB,IHC-P,FC expriments in human, mouse background without labeling.

HY-P82349

	ACE Antibody (YA2094) ACE; Dipeptidyl carboxypeptidase I; Kininase II; angiotensin converting enzyme 1 Antibody	WB, IHC-P	Mouse, Rat
	Angiotensin Converting Enzyme 1 Antibody (YA2094) is a rabbit-derived non-conjugated IgG antibody (Clone NO.: YA2094), targeting Angiotensin Converting Enzyme 1, with a predicted molecular weight of 151 kDa (observed band size: 180 kDa). Angiotensin Converting Enzyme 1 Antibody (YA2094) can be used for WB, IHC-P experiment in mouse, rat background.