Search Result
Results for "
Adjuvant
" in MedChemExpress (MCE) Product Catalog:
77
Biochemical Assay Reagents
7
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-153808
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
Complete Freund's adjuvant (CFA) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund to enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA) stimulates a strong and durable immune response and can be used to induce persistent inflammatory pain models in mice, experimental autoimmune myocarditis (EAM) models, and more. Incomplete Freund's adjuvant (IFA) (HY-153808A) is another type of Freund's Adjuvant that stimulates a weaker immune response .
|
-
-
- HY-153209G
-
|
Biochemical Assay Reagents
|
Others
|
Adjuvant-4 (GMP) is a GMP grade Adjuvant-4. Adjuvant-4 is a vaccine adjuvant that enhances antigen-specific antibody titers and cytotoxic T lymphocyte (CTL) responses . Adjuvant is generally an oil-in-water emulsifier of mineral oil and mannitol monooleate.
|
-
-
- HY-153209
-
|
Biochemical Assay Reagents
|
Others
|
Adjuvant-4 is a vaccine adjuvant that enhances antigen-specific antibody titers and cytotoxic T lymphocyte (CTL) responses . Adjuvant is generally an oil-in-water emulsifier of mineral oil and mannitol monooleate.
|
-
-
- HY-160197
-
|
NOD-like Receptor (NLR)
|
Others
|
Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
|
-
-
- HY-160198
-
-
-
- HY-145439
-
|
Bacterial
NF-κB
|
Infection
|
Colistin adjuvant-1 is a colistin adjuvant, shows increased colistin potentiation activity against Gram-negative bacteria. Colistin adjuvant-1 inhibits NF-κB with an IC50 of 0.209 μM .
|
-
-
- HY-145440
-
|
Bacterial
|
Infection
|
Colistin adjuvant-2 is a colistin adjuvant, shows increased colistin potentiation activity against Gram-negative bacteria .
|
-
-
- HY-160197G
-
|
NOD-like Receptor (NLR)
|
Infection
Inflammation/Immunology
|
Aluminum phosphate adjuvant GMP is a Aluminum phosphate adjuvant produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
|
-
-
- HY-159930
-
|
Antibiotic
|
Infection
|
Antibiotic adjuvant 3 (compound 8g) is an antibiotic adjuvant with potent colistin-potentiating activity and low mammalian toxicity. Antibiotic adjuvant 3 has minimum re-sensitizing concentration of 0.25 μg/mL agnist of Escherichia coli AR-0493 .
|
-
-
- HY-159929
-
|
Antibiotic
|
Infection
|
Antibiotic adjuvant 2 (compound 5q) is an antibiotic adjuvant with potent colistin-potentiating activity and low mammalian toxicity. Antibiotic adjuvant 2 has minimum re-sensitizing concentration of 0.125 μg/mL agnist of Escherichia coli AR-0493 .
|
-
-
- HY-161870
-
|
Antibiotic
|
Infection
|
Antibiotic adjuvant 1 (compound 3e) is an antibiotic adjuvant that presents insufficient antibacterial activity (MIC > 128 µg/mL) and potentiate the activity of Cloxacillin (HY-B0466A)(66-fold) with synergistic effect .
|
-
-
- HY-153808A
-
Montanide ISA-51
|
Bacterial
|
Inflammation/Immunology
Cancer
|
Incomplete Freund's adjuvant (IFA) (Montanide ISA-51) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund. Incomplete Freund's adjuvant (IFA) does not contain inactivated tuberculosis bacilli and consists of petroleum jelly containing lanolin. Incomplete Freund's adjuvant (IFA) induces high antibody titers and long-lasting effector T cell responses with no long-term effects on collagen disease, tumors, or death. Complete Freund's adjuvant (CFA) (HY-153808) is another type of Freund's Adjuvant that stimulates a stronger immune response .
|
-
-
- HY-153808B
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
Complete Freund's adjuvant (CFA, 1 mg/ml) is an immunoadjuvant emulsified with antigen that can enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA, 1 mg/ml) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA, 1 mg/ml) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA, 1 mg/ml) stimulates a strong and durable immune response and can be used to induce rheumatoid arthritis in rats, and more .
|
-
-
- HY-150743C
-
-
-
- HY-150743
-
-
-
- HY-106027
-
RO 31-3948
|
PPAR
|
Metabolic Disease
Inflammation/Immunology
|
Romazarit (RO 31-3948) is an anti-inflammatory agent with antirheumatic effect. Romazarit exhibits PPARα agonist activity. Romazarit (30 mg/kg) inhibits the development of hindpaw inflammation in an adjuvant arthritis model .
|
-
-
- HY-169247
-
-
-
- HY-159913
-
-
-
- HY-150750A
-
|
Toll-like Receptor (TLR)
|
Cancer
|
ODN M362 sodium, a class C oligodeoxynucleotide, is a TLR-9 agonist and can be used as a vaccine adjuvant. ODN M362 sodium induces cancer cell apoptosis .
|
-
-
- HY-150750
-
-
-
- HY-159671B
-
-
-
- HY-159874
-
|
Interleukin Related
|
Cancer
|
KRN7000 analog 2 is a iNKT agonist, which is promising for research of antitumor agents and vaccine adjuvants.
|
-
-
- HY-159672B
-
-
-
- HY-150219
-
-
-
- HY-150724C
-
1018 ISS sodium
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
ODN 1018 sodium, an oligodeoxynucleotide, is a TLR-9 agonist. ODN 1018 sodium is also a synthetic immunostimulatory sequence that can be used as vaccine adjuvant. Sequence: 5′-TGACTGTGAACGTTCGAGATGA-3′ .
|
-
-
- HY-116230
-
|
Ser/Thr Protease
|
Inflammation/Immunology
|
BI-L-45 XX is an orally active anti-inflammatory agent. BI-L-45 XX can inhibit the release of neutrophil enzymes and chemotaxis, and is used in the study of adjuvant-induced arthritis .
|
-
-
- HY-W782032A
-
-
-
- HY-150724
-
1018 ISS
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
ODN 1018 (1018 ISS), an oligodeoxynucleotide, is a TLR-9 agonist. ODN 1018 is also a synthetic immunostimulatory sequence that can be used as vaccine adjuvant. Sequence: 5′-TGACTGTGAACGTTCGAGATGA-3′ .
|
-
-
- HY-163091
-
-
-
- HY-159914
-
-
-
- HY-159671A
-
3D-MPL (14) triethylamine
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
3D-Monophosphoryl Lipid (14) (3D-Monophosphoryl Lipid (14)) triethylamine is a TLR agonist that can be used as a vaccine adjuvant to enhance the immunogenicity of vaccines .
|
-
-
- HY-125685
-
|
Bacterial
Fungal
|
Cancer
|
Germacrene D is isolated from Solidago canadensis. Germacrene D has antibacterial and antifungal activities and can be used as an adjuvant agent in the application of aminoglycosides and azoles .
|
-
-
- HY-142998
-
|
Liposome
Interleukin Related
IFNAR
|
Infection
Inflammation/Immunology
|
Vaxfectin is a second-generation cationic lipid-based suspension that adjuvants effectively both pDNA and protein-based vaccines. Vaxfectin can boost the immune response against a range of pDNA-expressed pathogenic antigens in vivo. Vaxfectin can increase IgG titers and give rise to an IL-6 dependent enhancement of the humoral immune response without altering the Th1 type immune response. Vaxfectin can be studied for vaccine formulation .
|
-
-
- HY-167676
-
|
DNA/RNA Synthesis
|
Inflammation/Immunology
|
Cofpropamine, a caffeine derivative that inhibits polyadenylation, enhances the inhibitory effect of cyclophosphamide (HY-17420) in rat adjuvant arthritis and mouse collagen arthritis models .
|
-
-
- HY-120049
-
-
-
- HY-P10686
-
|
EGFR
|
Cancer
|
CH401 peptide is a HER2-derived antigen peptide. After being bound to the artificial viral capsid by a self-assembled β-cyclic peptide, CH401 peptide is encapsulated in a lipid bilayer containing the lipid adjuvant α-GalCer, and can be studied as a self-adjuvant anti-breast cancer vaccine candidate .
|
-
-
- HY-150218
-
ODN 2006 sodium; ODN 7909 sodium; PF-3512676 sodium; CpG 7909 sodium
|
Toll-like Receptor (TLR)
|
Cancer
|
Agatolimod sodium (ODN 2006) is a class B CpG ODN and is a TLR9 agonist. Agatolimod sodium can be used as vaccine adjuvant. Agatolimod sodium can be used for the research of cancer. Sequence: 5’-TCGTCGTTTTGTCGTTTTGTCGTT-3’ .
|
-
-
- HY-162725
-
|
Toll-like Receptor (TLR)
|
Infection
Inflammation/Immunology
|
TLR7 agonist 24 (Compound 21) is an agonist for TLR7 with EC50 of 3.72 μM. TLR7 agonist 24 can be used as a vaccine adjuvant when combined with Aluminum Hydroxide (HY-B1521), that enhances the immune response against SARS-CoV-2 and hepatitis B antigens .
|
-
-
- HY-N2216
-
Onjisaponin F
|
Influenza Virus
|
Infection
|
Polygalasaponin XXXI (Onjisaponin F) is an effective adjuvant for intranasal administration of influenza Influenza hemagglutinin (HA) vaccine to protect influenza virus infection .
|
-
-
- HY-144767
-
|
Bacterial
|
Infection
|
PA3552-IN-1 (compound 15) is an antibiotic adjuvant that restores sensitivity of MDR P. aeruginosa DK2 strain to Polymyxin B. PA3552-IN-1 can reduce PA3552 expression .
|
-
-
- HY-19542S1
-
C6-Cer-d11; N-Hexanoylsphingosine-d11
|
Apoptosis
Isotope-Labeled Compounds
|
Cancer
|
C6 Ceramide-d11 is deuterated labeled C6 Ceramide (HY-19542). C6-ceramide, a ceramide pathway activator, shows activity against a variety of cancer cell lines. C6-ceramide can be used as an adjuvant for chemotherapeutic agents, to enhance anti-tumor effects .
|
-
-
- HY-N3522
-
|
Others
|
Inflammation/Immunology
|
Platycoside E is a platycodigenin-type saponin isolated from the root of Platycodon grandiflorum with haemolytic activity and adjuvant potential. Platycoside E promotes the production of the sera OVA-specific IgG2a and IgG2b antibody in the ovalbumin (OVA)-immunized mice .
|
-
-
- HY-148068
-
|
STING
|
Inflammation/Immunology
Cancer
|
STING agonist-20 (compound 95) is a potent STING agonist used in the synthesis of XMT-2056. STING agonist-20 can be used as a vaccine adjuvant in the study of cancer and other inflammatory, immune diseases .
|
-
-
- HY-150501
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
Diprovocim-X (compound 35) is a potent TLR1/TLR2 (toll-like receptor 1/2) agonist, with EC50 values of 0.14 and 0.75 nM for hTLR1/TLR2 and mTLR1/TLR2, respectively. Diprovocim-X is a potent adjuvant in vivo in mice, and serves to stimulate the adaptive immune response .
|
-
-
- HY-150734A
-
|
Toll-like Receptor (TLR)
|
Infection
|
ODN 2007 sodium, a class B CpG ODN (oligodeoxynucleotide), is a Toll-like receptor (TLR) ligand. ODN 2007 sodium can be used as an immunomodulator, vaccine adjuvant, and enhance immune responses in mammals, fish, and humans. ODN 2007 sequence: 5'-TCGTCGTTGTCGTTTTGTCGTT-3' .
|
-
-
- HY-150734
-
|
Toll-like Receptor (TLR)
|
Infection
Inflammation/Immunology
|
ODN 2007, a class B CpG ODN (oligodeoxynucleotide), is a Toll-like receptor (TLR) ligand. ODN 2007 can be used as an immunomodulator, vaccine adjuvant, and enhance immune responses in mammals, fish, and humans. ODN 2007 sequence: 5'-TCGTCGTTGTCGTTTTGTCGTT-3' .
|
-
-
- HY-112137
-
|
Caspase
Interleukin Related
MyD88
|
Inflammation/Immunology
|
Trehalose-6,6'-dibehenate is an orally active glycolipid. Trehalose-6,6'-dibehenate activates Mincle and inflammasome, inducing IL-1β secretion in a caspase activity-dependent manner. Trehalose-6,6'-dibehenate exerts a Myd88-dependent adjuvant activity. Trehalose-6,6'-dibehenate induces Th-1/Th-17 immune responses .
|
-
-
- HY-168159
-
|
Toll-like Receptor (TLR)
NOD-like Receptor (NLR)
|
Inflammation/Immunology
|
TLR7 agonist 27 (compound 24) is a potent TLR7 agonist with an EC50 of 238.1 nM. TLR7 agonist 27 shows weak agonistic activity against NOD2 (nucleotide-binding oligomerization domain 2) (EC50 of 6.2 μM). TLR7 agonist 27 is a potent immunostimulant, and can be used as a vaccine adjuvant and/or immunotherapeutic .
|
-
-
- HY-162501
-
|
Piezo Channel
|
Inflammation/Immunology
|
Yaddle1 is an agonist of the mechano-activated ion channel (Piezo1) with a half-maximal effective concentration (MEC50) of 0.40 μM. Yaddle1 can significantly trigger Ca 2+ inflow in T cells and induce T cell activation response. Yaddle1 can be used in the study of vaccine adjuvants .
|
-
-
- HY-111792
-
CRX-601
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
GSK1795091 (CRX-601), an immunologic stimulator, is a synthetic TLR4 agonist. Antitumor activity. GSK1795091 can be used as a vaccine adjuvant to enhance both mucosal and systemic immunity to influenza virus vaccines. Not only, GSK1795091 inhibits tumor growth and increases the survival in mice model, but results in long term survival in influenza challenge model in mice .
|
-
- HY-111582
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
BBIQ is a imidazoquinoline compound and a potent and selectively toll-like receptor 7 (TLR7) agonist with an EC50 of 59.1 nM for human TLR7. BBIQ is a powerful vaccine adjuvant that enhances innate immune responses .
|
-
- HY-133166
-
|
TRP Channel
|
Neurological Disease
|
A-889425 is an oral active selective TRPV1 receptor antagonist with the with an IC50 of 335 nM (rat) and 34 nM (human). A-889425 has good penetration into the CNS and reduces mechanical allodynia and spinal neuron responses to mechanical stimulation of Complete Freund's adjuvant (HY-153808)-inflamed rat hind paws .
|
-
- HY-158694A
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
TLR7 agonist 20 hydrochloride is an imidazoquinoline analogue. TLR7 agonist 20 hydrochloride is a potent TLR7 specific agonist, with an EC50 value of 0.23 μM for hTLR7. TLR7 agonist 20 hydrochloride shows strong adjuvant activity on spike antibody levels which induces a strong T helper 1 (Th1) response with increase in IgG2b and IgG2c, in addition to IgG1 .
|
-
- HY-150742A
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
ODN 2336 sodium is a A-Class CpG ODN (oligodeoxynucleotides), is a potent TLR9 agonist. ODN 2336 sodium induces the production of IFN-α. ODN 2336 sodium up-regulates the expression of IP-10 mRNA and IL-18 mRNA. ODN 2336 sodium can be used as adjuvant of vaccines .
|
-
- HY-150742
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
ODN 2336 is a A-Class CpG ODN (oligodeoxynucleotides), is a potent TLR9 agonist. ODN 2336 induces the production of IFN-α. ODN 2336 up-regulates the expression of IP-10 mRNA and IL-18 mRNA. ODN 2336 can be used as adjuvant of vaccines .
|
-
- HY-158694
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
TLR7 agonist 20 (compound 23) is an imidazoquinoline analogue. TLR7 agonist 20 is a potent TLR7 specific agonist, with an EC50 value of 0.23 μM for hTLR7. TLR7 agonist 20 shows strong adjuvant activity on spike antibody levels which induces a strong T helper 1 (Th1) response with increase in IgG2b and IgG2c, in addition to IgG1 .
|
-
- HY-153879
-
|
Liposome
Toll-like Receptor (TLR)
|
Infection
Inflammation/Immunology
|
C12-TLRa is an ionized adjuvant lipid. C12-TLRa targets TLR7/8 receptors in endosomes. C12-TLRa enhances mRNA delivery as a structural component of LNPs. C12-TLRa enhances innate immune responses. C12-TLRa can be used for the research of SARS-CoV-2 mRNA vaccine .
|
-
- HY-113462
-
|
Others
|
Cancer
|
α-Carotene, a precursor of vitamin A, is used as an anti-metastatic agent or as an adjuvant for anti-cancer agents. α-Carotene is isolated from yellow-orange and dark-green vegetables .
|
-
- HY-B2241A
-
Aluminum potassium sulfate dodecahydrate, for cell culture
|
Biochemical Assay Reagents
|
Others
|
Potassiumalum, for cell culture (Aluminum potassium sulfate dodecahydrate, for cell culture) is an egg white adjuvant that can induce allergic reactions in mice; it can also be used for bacterial staining. Potassiumalum, for cell culture is a biomaterial or organic compound that can be used in life science research .
|
-
- HY-N7819
-
Norphytane
|
Others
|
Inflammation/Immunology
|
Pristane (Norphytane) is a naturally occurring hydrocarbon oil found in small quantities in many plants, in various marine organisms, and as the most active component of mineral oil . Pristane is a non-antigenic adjuvant, and induces MHC class II-restricted, arthritogenic T cells in the rat .
|
-
- HY-144002
-
RC-529
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
RIBI-529 (RC-529), a lipid A mimetic (aminoalkyl glucosaminide 4-phosphate), is a adjuvant with a similar efficacy to MPL (Corixa). RIBI-529 signals through Toll-like receptor 4 to stimulate the innate immune system .
|
-
- HY-W062216
-
|
Bacterial
Arginase
|
Infection
|
2-Aminoimidazole is a potent antibiofilm agent that can be used as an adjuvant to antimicrobial. 2-aminoimidazoles disrupts the ability of bacteria to protect themselves by inhibiting biofilm formation and genetically-encoded antibiotic resistance traits. 2-Aminoimidazole is also a weak noncompetitive inhibitor of human arginase I with a Ki of 3.6 mM .
|
-
- HY-121496
-
|
Toll-like Receptor (TLR)
Influenza Virus
|
Infection
Inflammation/Immunology
Cancer
|
3M-011 is a potent dual toll-like receptor TLR7/8 agonist and a cytokine inducer. 3M-011 significantly inhibits H3N2 influenza viral replication in the nasal cavity. 3M-011 is also a potent adjuvant to radiotherapy that induces local and profound systemic immune responses during radiotherapy. 3M-011 strongly has antitumor action .
|
-
- HY-163670
-
|
Toll-like Receptor (TLR)
|
Infection
|
TLR7 agonist 21 (Compound 27B) is a selective agonist for Toll-like receptor 7(TLR7), with an EC50 of 17.53 nM (for human TLR7) and 41.7 nM (for mouse TLR7). TLR7 agonist 21 stimulates the secretion of pro-inflammatory cytokines, such as IL-6, TNF-α, IFN-α1, and IL-4. TLR7 agonist 21 acts as a vaccine adjuvant, increases levels of IgG and IgA, and protects the mouse from influenza virus infections .
|
-
- HY-101092
-
QS-21
4 Publications Verification
Stimulon
|
NOD-like Receptor (NLR)
|
Inflammation/Immunology
Cancer
|
QS-21, an immunostimulatory saponin, could be used as a potent vaccine adjuvant. QS-21 stimulates Th2 humoral and Th1 cell-mediated immune responses through action on antigen presenting cells (APCs) and T cells. QS-21 can activate the NLRP3 inflammasome with subsequent release of caspase-1 dependent cytokines, IL-1β and IL-18 .
|
-
- HY-B1521
-
|
NOD-like Receptor (NLR)
|
Cardiovascular Disease
Inflammation/Immunology
|
Aluminum Hydroxide is an orally active main form of aluminum used as adjuvant. Aluminum hydroxide-based adjuvant researches include the repository effect, pro-phagocytic effect, and activation of the pro-inflammatory NLRP3 pathway. Aluminum Hydroxide also acts as adjuvant to compensate low inherent immunogenicity of subunit vaccines .
|
-
- HY-150726
-
|
Toll-like Receptor (TLR)
Bacterial
|
Infection
Neurological Disease
Inflammation/Immunology
|
ODN 1668, a class B CpG ODN (oligodeoxynucleotide), is a TLR-9 agonist. ODN 1668 has strong immune regulatory properties, can enhance the level of antibody IgG2 subtype, promote the immune response of T cells and B cells, and can be used in the study of vaccine adjuvants. In addition, CpG ODN 1668 induces an antimicrobial immune response via a CaTLR9 dependent pathway in groupers. Sequence: 5'-tccatgacgttcctgatgct-3’ .
|
-
- HY-150726C
-
|
Toll-like Receptor (TLR)
Bacterial
|
Infection
Neurological Disease
Inflammation/Immunology
|
ODN 1668 sodium, a class B CpG ODN (oligodeoxynucleotide), is a TLR-9 agonist. ODN 1668 sodium has strong immune regulatory properties, can enhance the level of antibody IgG2 subtype, promote the immune response of T cells and B cells, and can be used in the study of vaccine adjuvants. In addition, CpG ODN 1668 sodium induces an antimicrobial immune response via a CaTLR9 dependent pathway in groupers. Sequence: 5'-tccatgacgttcctgatgct-3’ .
|
-
- HY-123942
-
|
Toll-like Receptor (TLR)
TNF Receptor
p38 MAPK
NF-κB
|
Inflammation/Immunology
Cancer
|
Diprovocim is a potent TLR1/TLR2 agonist. Diprovocim elicits full agonist activity in human THP-1 cells (EC50=110 pM). Diprovocim stimulates the release of TNF-α from mouse macrophages (EC50=1.3 nM). Diprovocim activates downstream MAPK and NF-κB signaling pathway. Diprovocim displays strong adjuvant activity in mice, particularly abetting cellular immune responses .
|
-
- HY-159746
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
HS801 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159748
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
M402 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159754
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
HS201 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159753
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
HS105 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159743
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
M101 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159751
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
HS101 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159744
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
M103 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159747
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
M401 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159750
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
M903 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-B1521R
-
|
NOD-like Receptor (NLR)
Reference Standards
|
Inflammation/Immunology
|
Aluminum Hydroxide (Standard) is the analytical standard of Aluminum Hydroxide. This product is intended for research and analytical applications. Aluminum Hydroxide is an orally active main form of aluminum used as adjuvant. Aluminum hydroxide-based adjuvant researches include the repository effect, pro-phagocytic effect, and activation of the pro-inflammatory NLRP3 pathway. Aluminum Hydroxide also acts as adjuvant to compensate low inherent immunogenicity of subunit vaccines .
|
-
- HY-159918
-
-
- HY-168204
-
|
Bacterial
Fungal
|
Infection
|
3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid (compound J1) is a potent antimicrobial agent. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid shows anti-gram-positive bacteria and fungi activity. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic acid can be used as antibiotic adjuvants. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic disrupts the bacterial cell membrane, inserts into the DNA, and binds to DNA gyrase. 3-Acetyl-28-N–(3–guanidinobutoxy)-oleanolic reduces microbial count in a mouse MRSA skin infection model and accelerates wound healing .
|
-
- HY-161561
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
PROMETON/OVA is an antigen-adjuvant conjugate formed by the coupling of PROMETON and ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and enhances cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161583
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Marijuana/BSA is the antigen-adjuvant conjugate of Marijuana and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-119866
-
-
- HY-138139B
-
T785 trihydrochloride
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
AXC-715 (T785) trihydrochloride is a TLR7/TLR8 dual agonist. AXC-715 trihydrochloride can be used for synthesis of antibody-adjuvant immunoconjugates, comprising an antibody construct that binds programmed death-ligand 1 (PD-L1) linked to one or more adjuvants .
|
-
- HY-138139A
-
T785 hydrochloride
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
AXC-715 (T785) hydrochloride is a TLR7/TLR8 dual agonist. AXC-715 can be used for synthesis of antibody-adjuvant immunoconjugates, comprising an antibody construct that binds programmed death-ligand 1 (PD-L1) linked to one or more adjuvants .
|
-
- HY-161562
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
PROMETON/BSA is an antigen-adjuvant conjugate formed by the coupling of PROMETON with bovine serum albumin (BSA). By coupling the antigen to the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-156616
-
|
Liposome
|
Inflammation/Immunology
|
VC1052 is a dialkoxypropylammonium-based material and is the core cationic lipid component of the cationic lipid adjuvant Vaxfectin (HY-142998). Vaxfectin consists of VC1052 and lipid DPyPE (HY-112766) in a 1:1 molar ratio. Vaxfectin can be used as a vaccine adjuvant for the preparation of plasmid DNA and protein vaccines .
|
-
- HY-161529
-
|
Angiotensin Receptor
|
Inflammation/Immunology
|
Angiotensin I/BSA is an antigen-adjuvant conjugate of Angiotensin I and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161549
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Phosphotyrosine/BSA is an antigen-adjuvant conjugate formed by coupling Phosphotyrosine with Bovine Serum Albumin (BSA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161553
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Biotin/KLH is an antigen-adjuvant conjugate that consists of Biotin and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163556
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
COT/BSA is the antigen-adjuvant conjugate of COT (cyclooctatetraene) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-101871
-
-
- HY-161558
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Ractopamine/KLH is an antigen-adjuvant conjugate of Ractopamine (HY-113781) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161533
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Digoxin/BSA is an antigen-adjuvant conjugate of Digoxin (HY-B1049) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161542
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Isoniazid/BSA is an antigen-adjuvant conjugate of Isoniazid (HY-B0329) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161540
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Oxytetracycline/OVA is an antigen-adjuvant conjugate formed by the coupling of Oxytetracycline (HY-B0275) with ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, it enhances the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or destroy the major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163555
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
BZO/BSA is an antigen-adjuvant conjugate formed by the coupling of BZO (benzodiazepine) with bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161555
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Clenbuterol/KLH is an antigen-adjuvant conjugate of Clenbuterol (HY-B1615) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161554
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Clenbuterol/BSA is an antigen-adjuvant conjugate of Clenbuterol (HY-B1615) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161566
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
DHT/BSA is an antigen-adjuvant conjugate formed by the coupling of DHT (dihydrotestosterone) and bovine serum albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161532
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Eugenol/OVA is an antigen-adjuvant conjugate formed by the conjugation of Eugenol (HY-N0337) with Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161591
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
SEM/BSA is an antigen-adjuvant conjugate formed by the conjugation of SEM (furanesalin) with bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161594
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Furazolidone/BSA is the antigen-adjuvant conjugate of Furazolidone (HY-B1336) and bovine serum albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161530
-
|
Angiotensin Receptor
|
Inflammation/Immunology
|
Angiotensin II/BSA is an antigen-adjuvant conjugate formed by the coupling of Angiotensin II with bovine serum albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163553
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Metronidazole/BSA is an antigen-adjuvant conjugate of Metronidazole (HY-B0318) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-139703
-
-
- HY-161557
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Ractopamine/BSA is an antigen-adjuvant conjugate formed by the conjugation of Ractopamine (HY-113781) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161590
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
AHD/BSA is the antigen-adjuvant conjugate of AHD (furan-2-carboxylic acid) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy the main epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161586
-
-
- HY-161546
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Melamine/KLH is an antigen-adjuvant conjugate formed by coupling Melamine (HY-Y1117) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the primary epitopes, and can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161547
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Tetracycline/BSA is an antigen-adjuvant conjugate formed by the conjugation of Tetracycline (HY-A0107) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it enhances cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161535
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Oxytetracycline/BSA is an antigen-adjuvant conjugate formed by the coupling of Oxytetracycline (HY-B0275) with Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161580
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
3-Nitrotyrosine/BSA is an antigen-adjuvant conjugate formed by the conjugation of 3-Nitrotyrosine with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it enhances cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161528
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
T3/OVA is an antigen-adjuvant conjugate formed by conjugating T3 (thyroxine) with ovalbumin (OVA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161560
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Tacrolimus/BSA is the antigen-adjuvant conjugate formed by the conjugation of Tacrolimus (HY-13756) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161541
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Estradiol/BSA is the antigen-adjuvant conjugate formed by the coupling of Estradiol (HY-B0141) with Bovine Serum Albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161589
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
GABA/KLH is an antigen-adjuvant conjugate formed by the coupling of GABA (γ-aminobutyric acid) with keyhole limpet hemocyanin (KLH). By coupling the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161534
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Sulfadiazine/BSA is an antigen-adjuvant conjugate formed by the conjugation of Sulfadiazine (HY-B0273) with Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161552
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
T3/BSA is an antigen-adjuvant conjugate of T3 (thyroid hormone) and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161588
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
GABA/BSA is an antigen-adjuvant conjugate formed by the coupling of GABA (γ-aminobutyric acid) with Bovine Serum Albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161559
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Sudan I/OVA is an antigen-adjuvant conjugate formed by coupling Sudan I (HY-D0024) with Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the main epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161585
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Diethylstilbestrol/KLH is an antigen-adjuvant conjugate formed by the coupling of Diethylstilbestrol (HY-14598) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-B1422
-
Aminacrine
|
Bacterial
HIV
|
Infection
|
9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
- HY-126715
-
-
- HY-101950
-
KIN1148
2 Publications Verification
|
Influenza Virus
|
Infection
|
KIN1148, a small-molecule IRF3 agonist, is a novel influenza vaccine adjuvant found to enhance flu vaccine efficacy.
|
-
- HY-161545
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Sudan I/BSA is the antigen-adjuvant conjugate formed by Sudan I (HY-D0024) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161556
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Alginic acid/KLH is an antigen-adjuvant conjugate formed by the coupling of Alginic acid (HY-W127758) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161526
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
T3/KLH is an antigen-adjuvant conjugate formed by the coupling of T3 (thyroid hormone) with keyhole limpet hemocyanin (KLH). By coupling the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161584
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Sudan I/KLH is an antigen-adjuvant conjugate formed by the coupling of Sudan I (HY-D0024) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161565
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Gastrin(1-17)/BSA is an antigen-adjuvant conjugate formed by the coupling of Gastrin(1-17) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-163552
-
|
Prostaglandin Receptor
|
Inflammation/Immunology
|
Prostaglandin F2a/BSA is an antigen-adjuvant conjugate formed by the conjugation of Prostaglandin F2a with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation as well as the generation of antigen-specific T cells.
|
-
- HY-161563
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
4,4'-Sulfonyldiphenol/BSA is the antigen-adjuvant conjugate of 4,4'-Sulfonyldiphenol (HY-W011927) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-N11630
-
|
Influenza Virus
|
Others
|
Pinellic acid is a natural product that could be isolated from a medicinal plant Pinelliae tuber. Pinellic acid is an effective oral adjuvant for nasal influenza vaccine .
|
-
- HY-107634
-
-
- HY-B1422R
-
Aminacrine (Standard)
|
Reference Standards
Bacterial
HIV
|
Infection
|
9-Aminoacridine (Standard) is the analytical standard of 9-Aminoacridine. This product is intended for research and analytical applications. 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
- HY-139719
-
|
NF-κB
|
Inflammation/Immunology
|
IMD-biphenylC is a novel imidazoquinolinone-NF-κB immunomodulator dimer that inhibits tumor proliferation while induces low systemic inflammation and reduces adjuvant toxicity.
|
-
- HY-14769A
-
5,10-Methylenetetrafolate calcium; ANX-510
|
Endogenous Metabolite
|
Cancer
|
Folitixorin calcium is a cofactor and an analog of leucovorin. Folitixorin calcium is a promising agent for modulation of 5-FU cytotoxicity in adjuvant cancer research .
|
-
- HY-139718
-
|
NF-κB
|
Inflammation/Immunology
|
IMD-biphenylB is a potent imidazoquinolinone-NF-κB immunomodulator dimer that inhibits tumor proliferation while induces low systemic inflammation and reduces adjuvant toxicity.
|
-
- HY-161551
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
25-OH Vitamin D3/KLH is an antigen-adjuvant conjugate of 25-OH Vitamin D3 (HY-158285) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-168137
-
-
- HY-114897
-
|
p38 MAPK
|
Inflammation/Immunology
|
L-167307 is an effective pyrrole-based p38 kinase inhibitor that can reduce secondary paw swelling in rat adjuvant-induced arthritis models .
|
-
- HY-14769
-
5,10-Methylenetetrafolate; ANX-510 free acid
|
Endogenous Metabolite
|
Cancer
|
Folitixorin (5,10-methylenetetrahydrofolate) is a cofactor and an analog of leucovorin. Folitixorin is a promising agent for modulation of 5-FU cytotoxicity in adjuvant cancer research .
|
-
- HY-150219A
-
-
- HY-139716
-
|
NF-κB
|
Inflammation/Immunology
|
IMD-catechol is a novel imidazoquinolinone-NF-κB immunomodulator dimer that improves efficacy in a CT26 mouse colon carcinoma tumor model while eliciting minimal adjuvant toxicity.
|
-
- HY-W782032
-
-
- HY-159100
-
-
- HY-126363
-
Diethyldithiocarbamic acid
|
HIV
|
Infection
Cancer
|
Ditiocarb (Diethyldithiocarbamic acid) is an accelerator of the rate of copper cementation. Ditiocarb (Diethyldithiocarbamic acid) reduces the incidence of HIV infection, and also enhances adjuvant immunoresearch of high risk breast cancer .
|
-
- HY-141420
-
|
Liposome
|
Inflammation/Immunology
|
PtdIns-(3,4,5)-P3(1,2-dihexanoyl) ammonium (compound 850176) is a vaccine adjuvant that enhances the immune function of vaccines .
|
-
- HY-152955
-
|
STING
|
Infection
Inflammation/Immunology
|
STING agonist-22 (CF501) is a potent non-nucleotide STING agonist. STING agonist-22 is a adjuvant by activating STING to induce the type I interferon (IFN-I) response and proinflammatory cytokine production. STING agonist-22 can be used as an adjuvant to boost the original protein vaccine, producing potent, broad, and long-term immune protection. STING agonist-22 can be used for SARS-CoV-2 variants and sarbecovirus diseases research .
|
-
- HY-NP141
-
4-Hydroxy-3-nitrophenylacetyl-bovine serum albumin
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
NP-BSA (4-Hydroxy-3-nitrophenylacetyl-bovine serum albumin) is an antigen-adjuvant conjugate of 4-Hydroxy-3-nitrophenylacetyl (NP) conjugated to bovine serum albumin (BSA), which is an immune complex. By conjugating antigens to protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and can enhance cross-presentation and the generation of antigen-specific T cells .
|
-
- HY-W782032B
-
-
- HY-159672A
-
-
- HY-N2258
-
|
Apoptosis
|
Inflammation/Immunology
|
Poncirin is isolated from Poncirus trifoliata with anti-inflammory activites. Poncirin significantly reduces mechanical hyperalgesia and allodynia in Complete Freund’s Adjuvant (CFA)-induced inflammatory pain models .
|
-
- HY-159670B
-
MPLA-12 triethylamine
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
Monophosphoryl Lipid A-12 (triethylamine) is a toll-like receptor 4 agonist. Monophosphoryl Lipid A-12 (triethylamine) can be used for the research of immunization and vaccine .
|
-
- HY-142123
-
|
Glucocorticoid Receptor
|
Inflammation/Immunology
|
Fluocortolone is an orally active anti-inflammatory agent that effectively reduces plasma fibrinogen levels. Fluocortolone inhibits Mycobacterium butyricum-induced foot edema in a rat model of adjuvanted joint inflammation (3-12 mg/kg) .
|
-
- HY-142123R
-
|
Glucocorticoid Receptor
Reference Standards
|
Inflammation/Immunology
|
Fluocortolone (Standard) is the analytical standard of Fluocortolone. This product is intended for research and analytical applications. Fluocortolone is an orally active anti-inflammatory agent that effectively reduces plasma fibrinogen levels. Fluocortolone inhibits Mycobacterium butyricum-induced foot edema in a rat model of adjuvanted joint inflammation (3-12 mg/kg) .
|
-
- HY-D1005A23
-
PEG-PPG-PEG, 4400 (Averag)
|
Biochemical Assay Reagents
|
Others
|
Poloxamer 401 L121 is block polymer of polyoxyethylene and polyoxypropylene. Poloxamer 401 L121 is utilized as lymphotrophic particles in nanoparticle engineering, as inhibitor of multidrug resistance and adjuvant activities or as surfactants and emulsifying agents in cosmetics .
|
-
- HY-106841
-
R-75231; R88021
|
Adenosine Receptor
Nucleoside Transporters
|
Inflammation/Immunology
|
Draflazine (R-75231) is a ENT1 inhibitor. Draflazine (R-75231) completely reverses the hypersensitivity in the complete Freund’s adjuvant (CFA) model of mechanical hyperalgesia and the carrageenan inflammation model of thermal and mechanical hyperalgesia .
|
-
- HY-P1771
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
OVA G4 peptide is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-16724
-
1-Methyl-D-tryptophan; NLG-8189
|
Indoleamine 2,3-Dioxygenase (IDO)
|
Cancer
|
Indoximod (1-Methyl-D-tryptophan) is an orally active indoleamine 2,3-dioxygenase (IDO) pathway inhibitor. Indoximod acts as a Trp mimetic in regulating mTOR. Indoximod is an immunometabolic adjuvant used for the research of cancer .
|
-
- HY-159919
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
UM-3006 is a highly efficient TLR7/8 agonist that enhances immune responses by activating the TLR signaling pathway. UM-3006 holds significant research and application potential in the fields of vaccine adjuvants and immune diseases .
|
-
- HY-P1771A
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
OVA G4 peptide TFA is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-N2843
-
|
Others
|
Inflammation/Immunology
|
α-Amyrin palmitate is isolated from Santalum album (sandalwood). α-Amyrin palmitate can be used for the study of arthritis in vivo .
|
-
- HY-163674
-
|
Interleukin Related
|
Inflammation/Immunology
|
Mincle agonist 1 (compound 1c) is a Mincle agonist. Mincle agonist 1 can promote IL-1β expression in BMDM cells. Mincle agonist 1 can be used in immune and inflammation related research .
|
-
- HY-144016
-
|
Liposome
|
Others
|
16:0 EPC chloride, a P-O-ethyl derivative, is a saturated cationic lipid. 16:0 EPC chloride can serve as a DNA and RNA transfecting agent. 16:0 EPC chloride can be used as a co-adjuvant for preparing vaccines and promote drug delivery .
|
-
- HY-113064
-
|
Endogenous Metabolite
|
Cancer
|
Selenocystine is a broad-spectrum anti-cancer agent. Selenocystine induces DNA damage in HepG2 cells, particularly in the form of DNA double strand breaks (DSBs). Selenocystine exhibits great promise as a therapeutic or adjuvant agent targeting DNA repair for cancer treatment .
|
-
- HY-N2258R
-
|
Reference Standards
Apoptosis
|
Inflammation/Immunology
|
Poncirin (Standard) is the analytical standard of Poncirin. This product is intended for research and analytical applications. Poncirin is isolated from Poncirus trifoliata with anti-inflammory activites. Poncirin significantly reduces mechanical hyperalgesia and allodynia in Complete Freund’s Adjuvant (CFA)-induced inflammatory pain models .
|
-
- HY-106526
-
Bactacine; Nanbacine
|
Bacterial
|
Infection
Inflammation/Immunology
|
Xibornol (Bactacine) has strong antibacterial action against Streptococcus pneumoniae, Streptococcus pyogenes, and Staphyloccus aureus, as well as against Actinomyces israelii and Corynebacterium ulcerans. Xibornol has the potential for using for the antisepsis of the oral cavity and as adjuvant in pharyngeal infections caused by Gram-positive microorganisms .
|
-
- HY-P1439
-
-
- HY-148663
-
Tripalmitoyl pentapeptide
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
Mitogenic Pentapeptide (Tripalmitoyl pentapeptide) is an effective activator of B lymphocyte mitogen and polyclonal. Mitogen Pentapeptide is a synthetic N-terminal analog of E. coli outer membrane lipoproteins (cysteinyl-seryl-seryl-asparaginyl-alanine). Mitogenic Pentapeptide can be used for the study of immune adjuvants .
|
-
- HY-122991
-
|
Histone Methyltransferase
|
Neurological Disease
|
Prospasmine hydrochloride is an anticholinergic drug that has the activity of inhibiting glandular secretions and relaxing smooth muscles. Prospasmine hydrochloride is mainly used to inhibit certain types of gastrointestinal disorders. Prospasmine hydrochloride helps relieve pain caused by smooth muscle spasms. Prospasmine hydrochloride is also used as an anesthetic adjuvant in some cases .
|
-
- HY-159102
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
PVP-037.2 is a TLR7/8 agonist. PVP-037.2 can serve as an adjuvant to enhance vaccine-induced TH1 type immune responses, increasing the production of antigen-specific antibodies IgG1 and IgG2c .
|
-
- HY-D1056B4
-
LPS, from bacterial (Salmonella typhosa)
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
Lipopolysaccharides, from Salmonella typhosa are lipopolysaccharide endotoxins and TLR-4 activators derived from Salmonella typhosa, classified as S-type LPS, which can activate pathogen-associated molecular patterns (PAMP) of the immune system and induce cellular secretion of migrasomes. Lipopolysaccharides, from Salmonella typhosa exhibit a typical three-part structure: O-antigen, core oligosaccharide, and lipid A. Lipopolysaccharides, from Salmonella typhosa can serve as vaccine adjuvants and demonstrate adjuvant activity targeting B cells in immune responses in vivo .
It is recommended to prepare a stock solution of ≥2 mg/mL and ensure that it is fully mixed and dissolved. Due to the adsorption characteristics of LPS, low adsorption centrifuge tubes should be used for aliquoting and storage.
|
-
- HY-163704
-
|
IFNAR
Interleukin Related
|
Inflammation/Immunology
Cancer
|
KRN7000 analog 1 exhibits good Th1-biased immune response through induction of interferon-γ (IFN-γ) and reduction of interleukin-4 (IL-4). KRN7000 analog 1 is potential as an antitumor agent and vaccine adjuvant .
|
-
- HY-W009722
-
Ditiocarb sodium trihydrate
|
HIV
Biochemical Assay Reagents
|
Infection
|
Sodium diethylcarbamodithioate (Ditiocarb sodium) trihydrate is a copper reagent. The reaction with Cu 2+ solution resulted in the formation of a complex, which increased the copper displacement precipitation rate. Sodium diethylcarbamodithioate trihydrate can reduce HIV infection and can be used in adjuvant immune research of high-risk breast cancer .
|
-
- HY-N8458
-
NSC 272693
|
PGE synthase
|
Inflammation/Immunology
|
Cryogenine is an alkaloid originally isolated from H. salicifolia that has anti-inflammatory activity. It inhibits prostaglandin synthetase (IC50=424 μM). Cryogenine (100 mg/kg per day, p.o.) reduces paw edema and the mean arthritic index in a rat model of adjuvant-induced polyarthritis.
|
-
- HY-161544
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Cholyglycine/BSA is a conjugate of Cholyglycine and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-B1250
-
|
Biochemical Assay Reagents
|
Cancer
|
Acedoben is a biochemical agent. Acedoben and iron ions can construct a fast self-assembled coordination complex. The Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
-
- HY-17556A
-
Leucovorin disodium
|
Endogenous Metabolite
Antifolate
|
Cancer
|
Folinic acid (Leucovorin) disodium is a biological folic acid and is a forms of vitamin B9. Folinic acid disodium is generally administered along with Methotrexate (MTX) (HY-14519) as a rescue agent to decrease MTX-induced toxicity. Folinic acid disodium and Sfluorouracil adjuvant chemotherapy shows effective in colon carcinoma .
|
-
- HY-B1250A
-
|
Biochemical Assay Reagents
|
Cancer
|
Acedoben sodium is the sodium salt form of Acedoben. Acedoben and iron ions can construct a rapidly self-assembled coordination complex, and the Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
-
- HY-163399
-
|
Bacterial
|
Infection
|
Antibacterial agent 197 (compound 1-deAA) is a termination inhibitor of non-classical anhydroglycosyl receptors and anhydrowall peptide-type peptidoglycan (PG) in bacterial TGase, with activity against Staphylococcus aureus. Antibacterial agent 197 synergizes with Vancomycin (HY-B0671) and is its antibacterial adjuvant .
|
-
- HY-168906
-
|
Bradykinin Receptor
|
Neurological Disease
Inflammation/Immunology
|
BI-113823 is an orally active and selective bradykinin B1 receptor antagonist. BI-113823 can reduce complete Freund's adjuvant (HY-153808)-induced mechanical hyperalgesia in rats. BI-113823 can be used for the research of chronic inflammatory pain .
|
-
- HY-N9517
-
QS 7 Api
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
QS 7 (QS 7 Api) is a saponin compound that can be extracted from the Quillaja saponaria tree. QS 7 activates immune cells, enhances their antigen presentation ability and cytokine secretion. QS 7 can be used as vaccine adjuvant for immunostimulating, anti-tumor, and anti-infectious activities .
|
-
- HY-P1439A
-
|
Toll-like Receptor (TLR)
NF-κB
|
Inflammation/Immunology
|
RS 09 TFA is an LPS (HY-D1056) peptide mimic and TLR4 agonist. RS 09 TFA can bind to TLR-4 and activate NF-κB. RS 09 TFA can function as an adjuvant in vivo, enhancing the antigen-specific immune response .
|
-
- HY-161543
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
DHT/KLH is a conjugate of DHT (dihydrotestosterone) and keyhole limpet hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt linear epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-123693
-
|
Insecticide
|
Inflammation/Immunology
|
ML358 is a first in class, potent, and selective inhibitor of the SKN-1 pathway (IC50=0.24 μM). ML358 sensitizes the model nematode C. elegans to oxidants and anthelmintic. ML358 potentially used as adjuvants to increase the efficacy and useful life of current anthelmintics .
|
-
- HY-161587
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Chloramphenicol/OVA is a conjugate of Chloramphenicol (HY-B0239) and Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161581
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Metronidazole/OVA is a conjugate of Metronidazole (HY-B0318) and Ovalbumin (OVA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the primary epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-126363S
-
Diethyldithiocarbamic acid-d10
|
Isotope-Labeled Compounds
HIV
|
Infection
|
Ditiocarb-d10 (Diethyldithiocarbamic acid-d10) is the deuterium labeled Ditiocarb (HY-126363) . Ditiocarb (Diethyldithiocarbamic acid) is an accelerator of the rate of copper cementation. Ditiocarb (Diethyldithiocarbamic acid) reduces the incidence of HIV infection, and also enhances adjuvant immunoresearch of high risk breast cancer .
|
-
- HY-162726
-
|
Interleukin Related
|
Cancer
|
GCS-11 is a powerful natural killer T (NKT) cell agonist. It boosts the production of IFN-γ and IL-4, with a particular selectivity for IFN-γ. GCS-11 exhibits anticancer activity. GCS-11 has the potential for research into cancer immunotherapies or vaccine development as a promising adjuvant .
|
-
- HY-161548
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Metronidazole/KLH is a conjugate of Metronidazole (HY-B0318) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-114565
-
|
Lipoxygenase
Enterovirus
|
Inflammation/Immunology
|
LY221068 is an anti-oxidant and an orally active, potent inhibitor of iron-dependent lipid peroxidation and 5-lipoxygenase with antiinflammatory properties. LY221068 inhibits bone damage and paw swelling in the Freund's Complete adjuvant (HY-153808) induced arthritis (FCA) model of rats. LY221068 is promising for research of arthritis .
|
-
- HY-161531
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
Diethylstilbestrol/BSA is a conjugate of Diethylstilbestrol (HY-14598) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-N7819S
-
|
Isotope-Labeled Compounds
|
Inflammation/Immunology
|
Pristane-d40 is the deuterium labeled Pristane . Pristane (Norphytane) is a naturally occurring hydrocarbon oil found in small quantities in many plants, in various marine organisms, and as the most active component of mineral oil . Pristane is a non-antigenic adjuvant, and induces MHC class II-restricted, arthritogenic T cells in the rat .
|
-
- HY-19543
-
Brusatol
Maximum Cited Publications
32 Publications Verification
NSC 172924
|
Keap1-Nrf2
Apoptosis
|
Cancer
|
Brusatol (NSC?172924) is a unique inhibitor of the Nrf2 pathway that sensitizes a broad spectrum of cancer cells to Cisplatin and other chemotherapeutic agents. Brusatol enhances the efficacy of chemotherapy by inhibiting the Nrf2-mediated defense mechanism. Brusatol can be developed into an adjuvant chemotherapeutic agent . Brusatol increases cellular apoptosis .
|
-
- HY-163550
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
5-MethylCytosine/BSA is a conjugate of 5-MethylCytosine (HY-W008091) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-105084
-
|
Sodium Channel
|
Neurological Disease
|
Lubeluzole is a neuroprotective anti-ischemic compound. Lubeluzole, but not its (-)-R-isomer, protects against sensorimotor deficits provoked by photochemical stroke in rats. Lubeluzole inhibited glutamate-stimulated guanosine 3',5'-cyclic monophosphate production with an IC50 of 37 nM. Lubeluzole also has the potential for developing a novel class of antibacterial adjuvants endowed with spasmolytic activity .
|
-
- HY-148016
-
|
Protease Activated Receptor (PAR)
ERK
|
Inflammation/Immunology
|
I-287 is a orally active selective PAR2 inhibitor that acting as a negative allosteric regulator on Gαq and Gα12/13 activity and their downstream effectors. I-287 reduces Complete Freund's adjuvant (HY-153808)-induced inflammation in mice and can be used for inflammation/immunology research .
|
-
- HY-W116335A
-
|
Endogenous Metabolite
Biochemical Assay Reagents
|
|
Dried aluminum hydroxide gel is a commonly used antacid with significant compound adhesion and release activity. Dried aluminum hydroxide gel can effectively neutralize gastric acid and relieve stomach discomfort. Dried aluminum hydroxide gel is also often used as an adjuvant in vaccines to enhance immune response. Dried aluminum hydroxide gel can improve the stability and bioavailability of compounds in preparations.
|
-
- HY-111582G
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
BBIQ (GMP) is BBIQ (HY-111582) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. BBIQ is a potent and selectively toll-like receptor 7 (TLR7) agonist with an EC50 of 59.1 nM. BBIQ is a powerful vaccine adjuvant that enhances innate immune responses .
|
-
- HY-155801
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
Cancer
|
CRX 527 is a ligand of TLR4 and also serves as an adjuvant for peptide-based cancer vaccines, showing potential to enhance anti-tumor immune responses. CRX 527 can also induce HSC differentiation, increase the proportion and quantity of LSK cells, and promote their differentiation into macrophages, activating immune defense and protecting intestinal epithelium from radiation damage .
|
-
- HY-129555
-
|
Bacterial
HSV
Antibiotic
|
Infection
|
Surfactin is a potent cyclic lipopeptide biosurfactants consists of four isomers (Surfactin A, B, C and D), which mediates flux of mono-and divalent cations, such as calcium, across lipid bilayer membranes. Surfactin can act as an antimicrobial adjuvant with anti-bacterial, anti-fungal, antimycoplasma and hemolytic effects . Surfactin also has antiviral activity against a variety of enveloped viruses .
|
-
- HY-150744A
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
ODN 24888 sodium is an guanine-modified inhibitory oligonucleotides (INH-ODN), shows potent inhibition on TLR7/TLR9-mediated signaling. ODN 24888 sodium impairs IFN-α level and NF-κB activation, inhibits IL-6 release. ODN 24888 sodium involves in immune and inflammatory responses, can be used as a vaccine adjuvant .
|
-
- HY-119530
-
BW 57-323
|
Nucleoside Antimetabolite/Analog
|
Others
|
Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
|
-
- HY-W766751
-
5,10-Methylenetetrafolate-d4; ANX-510 free acid-d4
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Cancer
|
Folitixorin-d4 (5,10-Methylenetetrafolate-d4; ANX-510 (free acid)-d4) is the deuterium labeled Folitixorin (HY-14769). Folitixorin (5,10-methylenetetrahydrofolate) is a cofactor and an analog of leucovorin. Folitixorin is a promising agent for modulation of 5-FU cytotoxicity in adjuvant cancer research .
|
-
- HY-157444
-
|
HIF/HIF Prolyl-Hydroxylase
|
Cancer
|
5,3',4',3'',4'',5''-6-O-Ethyl-EGCG (Y6) is a potent adjuvant obtained by optimization of the structure of EGCG. 5,3',4',3'',4'',5''-6-O-Ethyl-EGCG (Y6) decreases the expression of HIF-1α and CBR1 at both the mRNA and protein levels .
|
-
- HY-W009722A
-
Ditiocarb sodium trihydrate, ACS, 99.0%
|
HIV
Biochemical Assay Reagents
|
Infection
|
Sodium diethylcarbamodithioate trihydrate, ACS, 99.0% (Ditiocarb sodium trihydrate, ACS, 99.0%) is a copper reagent. The reaction with Cu 2+ solution resulted in the formation of a complex, which increased the copper displacement precipitation rate. Sodium diethylcarbamodithioate trihydrate, ACS, 99.0% can reduce HIV infection and can be used in adjuvant immune research of high-risk breast cancer .
|
-
- HY-B1250R
-
|
Biochemical Assay Reagents
Reference Standards
|
Cancer
|
Acedoben (Standard) is the analytical standard of Acedoben. This product is intended for research and analytical applications. Acedoben is a biochemical agent. Acedoben and iron ions can construct a fast self-assembled coordination complex. The Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
-
- HY-150744
-
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
ODN 24888 is an guanine-modified inhibitory oligonucleotides (INH-ODN), shows potent inhibition on TLR7/TLR9-mediated signaling. ODN 24888 impairs IFN-α level and NF-κB activation, inhibits IL-6 release. ODN 24888 involves in immune and inflammatory responses, can be used as a vaccine adjuvant .
|
-
- HY-15041
-
|
Bradykinin Receptor
|
Inflammation/Immunology
|
NVP-SAA164 is an orally active nonpeptide kinin B1 receptor antagonist. NVP-SAA164 reverses CFA (Complete Freund's adjuvant) (HY-153808)-induced mechanical hyperalgesia and desArg10KD-induced hyperalgesia in hB1-KI mice, and is inactive in a model of inflammatory pain in wild-type mice .
|
-
- HY-156087G
-
|
Apoptosis
Necroptosis
|
Cancer
|
Cholicamideβ (GMP) is a GMP grade of Cholicamideβ. Cholicamideβ (compound 6) is a self-assembling, small molecule, cancer vaccine adjuvant. Cholicamideβ can form virus-like particles with low cytotoxicity. Cholicamideβ, upon binding to peptide antigens, enhances antigen presentation by dendritic cells and induces antigen-specific T cells. Cholicamideβ can induce apoptosis and necrosis .
|
-
- HY-12273G
-
|
TGF-β Receptor
Autophagy
|
Cancer
|
DMH-1 (GMP) is a GMP-grade version of DMH-1 (HY-12273). Small molecules of GMP grade can be used as adjuvant reagents in cell therapy. DMH-1 (GMP) promotes cardiac differentiation in mouse embryonic stem cells. DMH-1 (GMP) promotes neurogenesis of hiPSCs. DMH-1 is a potent and selective BMP inhibitor .
|
-
- HY-156087
-
|
Apoptosis
Necroptosis
|
Cancer
|
Cholicamideβ (GMP) is a GMP grade of Cholicamideβ. Cholicamideβ (compound 6) is a self-assembling, small molecule, cancer vaccine adjuvant. Cholicamideβ can form virus-like particles with low cytotoxicity. Cholicamideβ, upon binding to peptide antigens, enhances antigen presentation by dendritic cells and induces antigen-specific T cells. Cholicamideβ can induce apoptosis and necrosis .
|
-
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-141432G
-
Cbl-b-IN-3
|
E1/E2/E3 Enzyme
|
Inflammation/Immunology
Cancer
|
NX-1607 (Cbl-b-IN-3) (GMP) is a GMP-grade NX-1607 (HY-141432). GMP-grade small molecules can be used as adjuvant agents in cell therapy. NX-1607 (GMP) enhances antigen recall, reduces T cell exhaustion and increases cytokine production. NX-1607 is an inhibitor of Cbl-b (an E3 enzyme) .
|
-
- HY-N9470
-
|
Others
|
Inflammation/Immunology
Cancer
|
λ-Carrageenan is a seaweed polysaccharide which has been generally used as proinflammatory agent in the basic research. λ-Carrageenan is a potent antitumor agent .
|
-
- HY-12914
-
|
TRP Channel
|
Neurological Disease
Inflammation/Immunology
|
V116517 is a potent, orally active transient receptor potential vanilloid (TRPV1) antagonist. V116517 shows potent activity in inhibiting both capsaicin (CAP)- and acid (pH 5)-induced currents in rat DRG neurons expressing native TRPV (IC50=423.2 nM for CAP; IC50=180.3 nM for acid). V116517 can be used for the research of pain .
|
-
- HY-135748
-
Poly(I:C) sodium
|
Toll-like Receptor (TLR)
Apoptosis
|
Inflammation/Immunology
Cancer
|
Polyinosinic-polycytidylic acid (Poly(I:C)) sodium is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid sodium can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid sodium can directly trigger cancer cells to undergo apoptosis .
|
-
- HY-107202
-
Poly(I:C)
|
Toll-like Receptor (TLR)
PKD
HSP
Bcl-2 Family
Interleukin Related
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
Polyinosinic-polycytidylic acid (Poly(I:C)) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid can directly trigger cancer cells to undergo apoptosis .
|
-
- HY-134958
-
Poly(I:C) potassium
|
Toll-like Receptor (TLR)
Apoptosis
|
Inflammation/Immunology
Cancer
|
Polyinosinic-polycytidylic acid potassium (Poly(I:C) potassium) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid sodium can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid potassium can directly trigger cancer cells to undergoApoptosis .
|
-
- HY-167715
-
|
Histamine Receptor
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
Traxanox is an orally available diuretic that enhances phagocytosis of yeast granules by mouse peritoneal macrophages and rat peritoneal polymorphonuclear leukocytes in vitro.
Traxanox inhibits IgE-mediated histamine release and cyclic AMP phosphodiesterase
activity.Traxanox exhibits anti-inflammatory activity, as it inhibits the anaphylactoid reaction and reduces pleural fluid accumulation in experimental models of inflammation. Traxanox also demonstrates a synergistic effect when combined with hydrocortisone or indomethacin in suppressing adjuvant arthritis in rats.
|
-
- HY-14176G
-
γ-Secretase-IN-1
|
γ-secretase
|
Cancer
|
Compound E (GMP) is a GMP-grade Compound E (HY-14176). GMP-grade small molecules can be used as adjuvant reagents in cell therapy. Compound E is a γ-secretase inhibitor. Compound E inhibits β-amyloid(40), β-amyloid(42), and Notch γ-secretase cleavage with IC50 values of 0.24, 0.37, and 0.32 nM, respectively .
|
-
- HY-159902
-
|
Interleukin Related
|
Inflammation/Immunology
Cancer
|
KRN7000 analog 3 (Compound 14),α-GalCer (HY-102022) analogue, is a iNKT agonist. KRN7000 analog 3 induces higher levels of IL-2 cytokine secretion (49.2-62.6 ng/mL) than a-GalCer (44.1 ng/mL) in mNK1.2 cells. KRN7000 analog 3 is promising for research of antitumor agents and vaccine adjuvants .
|
-
- HY-119821R
-
|
Reference Standards
Glycosidase
|
Infection
|
Thiamiprine (Standard) is the analytical standard of Thiamiprine. This product is intended for research and analytical applications. Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
|
-
- HY-114873
-
LY25684
|
Phospholipase
COX
Lipoxygenase
Leukotriene Receptor
|
Inflammation/Immunology
|
LY256548 (LY25648) is an orally available anti-ischemic and anti-inflammatory compound with central nervous system activity. LY256548 is an inhibitor of phospholipase A2, 5-lipoxygenase (5-LOX), and COX, and inhibits A23187 (HY-N6687)-stimulated leukotriene B4 production. LY256548 inhibits bone damage and paw swelling in the rat Freund's complete adjuvant-induced arthritis (FCA) model .
|
-
- HY-119530R
-
BW 57-323 (Standard)
|
Nucleoside Antimetabolite/Analog
Reference Standards
|
Others
|
Thiamiprine (Standard) is the analytical standard of Thiamiprine. This product is intended for research and analytical applications. Thiamiprine (BW 57-323) is a compound related to azathioprine. Its nucleoside forms are similar to the parent compound in terms of cytotoxicity in vitro (except for the arabinoside). In the rat adjuvant arthritis model in vivo, its riboside and 2'-deoxyriboside are less active than the parent compound. The arabinoside is inactive and nontoxic. It has similar potency to the other parent compounds tested, but has a different safety profile.
|
-
- HY-144120
-
|
SARS-CoV
|
Infection
|
αGalCer-RBD is a self-adjuvanting lipoprotein conjugate. αGalCer-RBD induces potent immunity against SARS-CoV-2 and its variants of concern. αGalCer-RBD conjugate induces RBD-specific, cytokine-producing T cell development. αGalCer-RBD has great potential to be an effective COVID-19 vaccine candidate. α-Galactosylceramide (αGalCer) is a potent invariant natural killer T cell (iNKT) agonist . RBD: receptor-binding domain
|
-
- HY-P10701
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
Q11 peptide is a β-sheet-forming peptide that plays an important role in self-assembly and targeted applications. As a scaffold peptide, Q11 peptide can display immunogenic epitopes and is widely used in peptide-based immune vaccine research. Additionally, Q11 peptide can be conjugated with MUC1 glycopeptides for the study of self-assembling, adjuvant-free MUC1 glycopeptide vaccines. Q11 peptide holds great potential for research in the field of cancer immunology .
|
-
- HY-W014421
-
|
TRP Channel
|
Neurological Disease
|
AP-18, a potent and selective TRPA1 inhibitor, blocks activation of TRPA1 by 50 μM Cinnamaldehyde with an IC50 of 3.1 μM and 4.5 μM for human and mouse TRPA1, respectively. AP-18 reverses complete Freund's adjuvant (CFA)-induced mechanical hyperalgesia in mice. AP-18 attenuated 30 μM AITC-induced Yo-Pro uptake in a concentration-dependent manner, with an IC50 of 10.3 μM .
|
-
- HY-107510
-
|
mGluR
|
Neurological Disease
|
YM-230888 is an orally active, selective and allosteric mGlu1 receptor antagonist with a Ki of 13 nM. YM-230888 inhibits mGlu1-mediated inositol phosphate production in rat cerebellar granule cells with an IC50 of 13 nM. YM-230888 shows antinociceptive response in Streptozotocin (HY-13753)-induced hyperalgesia models. YM-230888 significantly reduces pain parameters in complete Freund's adjuvant (HY-153808)-induced arthritic pain models .
|
-
- HY-107632G
-
-
- HY-161525
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid linker/BSA is the conjugate of 1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid linker and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, it enhances the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-111164
-
|
p38 MAPK
Phosphodiesterase (PDE)
|
Inflammation/Immunology
|
CBS-3595 is a dual inhibitor of p38 MAP kinase and phosphodiesterase 4 with anti-inflammatory and anti-allodynic activities. CBS-3595 reduces the production of the proinflammatory cytokine IL-6 and increases the levels of the anti-inflammatory cytokine IL-10 in rats. CBS-3595 reduces paw oedema formation in the Complete Freund’s adjuvant (CFA) (HY-153808)-induced arthritis rat model. CBS-3595 is promising for research of autoimmune diseases .
|
-
- HY-125130
-
Hes-7-G
|
HMG-CoA Reductase (HMGCR)
Bacterial
Interleukin Related
|
Infection
Metabolic Disease
Inflammation/Immunology
|
Hesperetin 7-O-glucoside is a typical flavonoid monoglucoside, which is an anti-inflammatory agent and an antihypertensive with orally active. Hesperetin 7-O-glucoside is a commonly used food adjuvant. Hesperetin 7-O-glucoside inhibits human intestinal maltase and human HMG-CoA reductase with Ki of 1.8 mM and 9.8 μM, respectively. Hesperetin 7-O-glucoside has antibacterial activity and can regulate intestinal flora and metabolic homeostasis in mice .
|
-
- HY-11048
-
NS11394
3 Publications Verification
|
GABA Receptor
|
Neurological Disease
|
NS11394 is an orally active and unique subtype-selective GABAA positive allosteric receptor (PAM), with a Ki of ~0.5 nM. NS11394 shows a selectivity profile in the order of GABAA-5 > α3 > α2 > α1-containing receptors. NS11394 has anxiolytic and anti-inflammatory properties .
|
-
- HY-14305
-
|
p38 MAPK
|
Inflammation/Immunology
|
BMS-582949 (compound 7k) is an orally active and highly selective p38α MAP kinase inhibitor, with IC50 values of 13 nM for p38α, and 50 nM for cellular TNFα. BMS-582949 can be used for research on rheumatoid arthritis .
|
-
- HY-112766
-
|
Liposome
|
Others
|
DPyPE is a neutral phosphatidylethanolamine lipid composed of a polyisoprene alkyl chain with two pyridine-containing phosphine ligands. DPyPE is mainly used in liposome formulations and to enhance the efficiency of gene delivery in vitro and in vivo. For example, DPyPE can be mixed with cationic lipids such as VC1052 (HY-156616) (in a 1:1 ratio) to form the vaccine adjuvant Vaxfectin (HY-142998). DPyPE assists VC1052 in binding to negatively charged pDNA to form a uniform liposome complex by regulating the fluidity and stability of the liposome membrane .
|
-
- HY-B1138
-
CL-82204
|
COX
Caspase
|
Inflammation/Immunology
|
Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with analgetic and antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
|
-
- HY-10181G
-
BMS-354825 (GMP)
|
Src
Bcr-Abl
Apoptosis
Autophagy
|
Cancer
|
Dasatinib (BMS-354825) (GMP) is a GMP-grade Dasatinib (HY-10181). GMP-grade small molecules can be used as adjuvant agents in cell therapy. Dasatinib (BMS-354825) is an orally active, ATP-competitive, dual Src/Bcr-Abl inhibitor with potent antitumor activity. The Ki values for Src and Bcr-Abl are 16 pM and 30 pM, respectively. Dasatinib inhibits Bcr-Abl and Src with IC50 values of less than 1.0 nM and 0.5 nM, respectively. Dasatinib also induces apoptosis and autophagy .
|
-
- HY-12326A
-
Cyclic diadenylate disodium; Cyclic-di-AMP disodium
|
STING
Bacterial
Endogenous Metabolite
|
Inflammation/Immunology
|
c-di-AMP (Cyclic diadenylate) sodium is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP sodium is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP sodium acts as a potent mucosal adjuvant stimulating both humoral and cellular responses .
|
-
- HY-12326B
-
Cyclic diadenylate diammonium; Cyclic-di-AMP diammonium
|
STING
Bacterial
Endogenous Metabolite
|
Inflammation/Immunology
|
c-di-AMP diammonium is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP diammonium is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP diammonium acts as a potent mucosal adjuvant stimulating both humoral and cellular responses .
|
-
- HY-150725
-
|
IFNAR
TNF Receptor
|
Infection
Inflammation/Immunology
Cancer
|
ODN 1585 is a potent inducer of IFN and TNFα production. ODN 1585 is a potent stimulator of NK (natural killer) function. ODN 1585 increases CD8+ T-cell function, including the CD8+ T cell-mediated production of IFN-γ. ODN 1585 induces regression of established melanomas in mice. ODN 1585 can confer complete protection against malaria in mice. ODN 1585 can be used for acute myelogenous leukemia (AML) and malaria research. ODN 1585 can be used as a vaccine adjuvant .
|
-
- HY-150725C
-
|
TNF Receptor
IFNAR
|
Infection
Inflammation/Immunology
Cancer
|
ODN 1585 sodium is a potent inducer of IFN and TNFα production. ODN 1585 sodium is a potent stimulator of NK (natural killer) function. ODN 1585 sodium increases CD8+ T-cell function, including the CD8+ T cell-mediated production of IFN-γ. ODN 1585 sodium induces regression of established melanomas in mice. ODN 1585 sodium can confer complete protection against malaria in mice. ODN 1585 sodium can be used for acute myelogenous leukemia (AML) and malaria research. ODN 1585 sodium can be used as a vaccine adjuvant .
|
-
- HY-N0220
-
-
- HY-N0220R
-
-
- HY-12326
-
Cyclic diadenylate; Cyclic-di-AMP
|
STING
Bacterial
Endogenous Metabolite
|
Inflammation/Immunology
|
c-di-AMP (Cyclic diadenylate) is a STING agonist, which binds to the transmembrane protein STING thereby activating the TBK3-IRF3 signaling pathway, subsequently triggering the production of type I IFN and TNF. c-di-AMP (Cyclic diadenylate) is also a bacterial second messenger, which regulates cell growth, survival, and virulence, primarily within Gram-positive bacteria, and also regulates host immune response. c-di-AMP (Cyclic diadenylate) acts as a potent mucosal adjuvant stimulating both humoral and cellular responses .
|
-
- HY-107202GL
-
Poly(I:C) (GMP Like)
|
Toll-like Receptor (TLR)
PKD
HSP
Bcl-2 Family
Interleukin Related
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
Polyinosinic-polycytidylic acid (Poly(I:C)) (GMP Like) is the GMP Like class Polyinosinic-polycytidylic acid (HY-107202), and can be used as pharmaceutical excipients. Polyinosinic-polycytidylic acid (Poly(I:C)) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid can directly trigger cancer cells to undergo apoptosis .
|
-
- HY-B1138R
-
CL-82204 (Standard)
|
Reference Standards
COX
Caspase
|
Inflammation/Immunology
|
Fenbufen (Standard) is the analytical standard of Fenbufen. This product is intended for research and analytical applications. Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with analgetic and antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
|
-
- HY-B1138S
-
|
Isotope-Labeled Compounds
COX
Caspase
|
Inflammation/Immunology
|
Fenbufen-d9 (CL-82204-d9) is the deuterium labeled Fenbufen. Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
|
-
- HY-N0807
-
|
MMP
NF-κB
JAK
Keap1-Nrf2
|
Metabolic Disease
Inflammation/Immunology
Cancer
|
Swertiamarin is an orally active natural product with hypoglycemic, lipid-lowering, anti-rheumatic, and antioxidant activities. Swertiamarin can regulate the levels of pro-inflammatory cytokines, MMP, and NF-κB, and promote osteoblast proliferation. Swertiamarin has antioxidant and hepatoprotective effects against carbon tetrachloride induced rat liver toxicity through the Nrf2/HO-1 pathway. Swertiamarin can attenuate inflammatory mediators by regulating JAK2/STAT3 transcription factors in adjuvant induced arthritis rats. Swertiamarin can be used in the research of diabetes and arthritis .
|
-
- HY-107202A
-
|
Toll-like Receptor (TLR)
PKD
HSP
Bcl-2 Family
Interleukin Related
Apoptosis
|
Infection
Inflammation/Immunology
Cancer
|
Poly(I:C):Kanamycin (1:1) is a mixture of Poly(I:C) (HY-107202) and Kanamycin (HY-16566). Poly(I:C) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Poly(I:C) can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Poly(I:C) can directly trigger cancer cells to undergo apoptosis. Kanamycin stabilizes Poly(I:C) .
|
-
- HY-160719
-
|
Peptide-Drug Conjugates (PDCs)
|
Inflammation/Immunology
|
NHS-activated 2-octynoic acid-BSA is an immunogen used to establish a murine model of primary biliary cholangitis (PBC). NHS-activated 2-octynoic acid-BSA works in conjunction with Complete Freund's Adjuvant (HY-153808) to stimulate the body's immune system, causing the immune system to recognize it as a foreign antigen and trigger an immune response against autologous biliary epithelial cells. This leads to the production of anti-PDC-E2 antibodies, resulting in bile duct damage and inflammation. NHS-activated 2-octynoic acid-BSA is promising for research of primary biliary cholangitis .
|
-
- HY-150644
-
|
Aldose Reductase
|
Cancer
|
S07-2010 is a potent pan-AKR1C (aldo-keto reductase family 1 member C) inhibitor, with IC50 values of 0.19, 0.36, 0.47, and 0.73 μM for AKR1C3, AKR1C4, AKR1C1 and AKR1C2, respectively. S07-2010 induces apoptosis in A549/DDP cells. S07-2010 strengthens the cytotoxicity of chemotherapeutic agents in drug-resistant cells. S07-2010 significantly inhibits the proliferation of drug-resistant cells .
|
-
- HY-130605
-
|
P2X Receptor
|
Neurological Disease
|
BAY-1797 is a potent, orally active, and selective P2X4 antagonist, with an IC50 of 211 nM against human P2X4. BAY-1797 displays no or very weak activity on the other P2X ion channels. BAY-1797 shows anti-nociceptive and anti-inflammatory effects .
|
-
- HY-100754C
-
PF-06651600 tosylate
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
Ritlecitinib (PF-06651600) tosylate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib tosylate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib tosylate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
- HY-100754
-
PF-06651600
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
Ritlecitinib (PF-06651600) is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
- HY-15001G
-
SR1
|
Aryl Hydrocarbon Receptor
|
Cancer
|
Stemregenin 1 (SR1) (GMP) is a GMP-grade Stemregenin 1 (HY-15001). GMP-grade small molecules can be used as adjuvants in cell therapy. Stemregenin 1 is a potent aryl hydrocarbon receptor (AhR) antagonist with an IC50 of 127 nM. Stemregenin 1 (GMP) can competitively bind to AhR and inhibit its nuclear translocation, inhibiting osteoclastogenesis and promoting hematopoietic progenitor cell expansion by blocking the AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway. Stemregenin 1 (GMP) can be used for the treatment of osteoporosis, in vitro expansion of hematopoietic stem cells, and the study of the mechanism of bone metabolic diseases .
|
-
- HY-100754A
-
PF-06651600 (malonate)
|
JAK
Interleukin Related
STAT
|
Inflammation/Immunology
|
Ritlecitinib (PF-06651600) malonate is a highly selective, orally active, irreversible covalent JAK3 inhibitor (IC50=33 nM) without inhibitory activity towards JAK1, JAK2, and TYK2 (IC50 >10 μ M). Ritlecitinib malonate rapidly inactivates the JAK3 kinase, and blocks signaling and downstream STAT phosphorylation mediated by common gamma chain cytokines such as IL-2 and IL-15. Ritlecitinib malonate can inhibit Th1/Th17 cell differentiation and function, and effectively suppress preclinical animal models such as alopecia areata, adjuvant-induced arthritis (AIA), and experimental autoimmune encephalomyelitis (EAE) .
|
-
- HY-19542
-
C6-Cer; N-Hexanoylsphingosine
|
Apoptosis
|
Cancer
|
C6 Ceramide (C6-Cer) is a short-chain, cell-permeable ceramide pathway activator with anticancer activity. C6 Ceramide-mediated miR-29b expression participates in the progression of multiple myeloma through suppressing the proliferation, migration and angiogenesis of endothelial cells by targeting Akt signal pathway. C6 Ceramide exhibits multiple anti-cancer properties including cell cycle arrest, Apoptosis, inhibition of tumor growth and enhances the effects of chemotherapy in drug-resistant cancer cells. C6-ceramide can be used as an adjuvant for chemotherapeutic agents, to enhance anti-tumor effects .
|
-
- HY-121856
-
|
Others
|
Inflammation/Immunology
|
Flumizole, a derivative of substituted 5,6-diaryl-2,3-dihydroimidazo[2,1-b]thiazoles, was synthesized and evaluated for its immunoregulatory and anti-inflammatory properties in animal models such as rat adjuvant-induced arthritis and mouse oxazolone-induced contact sensitivity assays. This compound class combines structural elements from flumizole and levamisole, aiming to enhance therapeutic efficacy. Symmetrically substituted 5,6-diaryl compounds with specific alkyl heteroatom or halogen substitutions showed optimal potency in the arthritis model. However, variations in activity were less consistent in the contact sensitivity assay. Flumizole and related compounds demonstrate potential as dual-action agents, targeting inflammation and immune modulation, offering promise for therapeutic development in immune-related disorders .
|
-
- HY-173163
-
|
Bacterial
|
Infection
|
(E)-2,6-Di-tert-butyl-4-(4-(diethylamino)styryl)pyrylium (trifluoromethanesulfonate) (Compound 4a) is a Gram-negative outer membrane permeabilizer with synergistic antibacterial activity through the blockage on LptA/LptC interaction via targeting Met47 in LptA. (E)-2,6-Di-tert-butyl-4-(4-(diethylamino)styryl)pyrylium (trifluoromethanesulfonate) potentiates pol B against both wild-typed and MDR A. baumannii and E. coli strains. (E)-2,6-Di-tert-butyl-4-(4-(diethylamino)styryl)pyrylium (trifluoromethanesulfonate) can be used as antibiotic adjuvants against MDR Gram-negative bacteria .
|
-
- HY-B1422S
-
Aminacrine-13C6
|
Bacterial
HIV
Isotope-Labeled Compounds
|
Infection
|
9-Aminoacridine-13C6 is the 13C-labeled 9-Aminoacridine(HY-B1422). 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
- HY-135748A
-
|
Toll-like Receptor (TLR)
Apoptosis
|
Infection
Cancer
|
Poly (I:C):Kanamycin (1:1) sodium is an isometric complex of Poly (I:C) (HY-135748) and Kanamycin (HY-16566). Poly(I:C) sodium, a synthetic analog of double-stranded RNA, is a TLR3 and retinoic acid-inducible gene I receptor (RIG-I and b>MDA5) agonist. Poly(I:C) sodium can be used as a vaccine adjuvant to enhance innate and adaptive immune responses and induce apoptosis in cancer cells . Kanamycin is an orally active antibacterial agent (Gram-negative/positive bacteria) that inhibits translocation and causes miscoding by binding to the 70S ribosomal subunit. Kanamycin shows good inhibitory activity against Mycobacterium tuberculosis (susceptible and drug-resistant) and Klebsiella pneumoniae, and can be used in the research of tuberculosis and pneumonia .
|
-
- HY-146427
-
|
Fungal
|
Infection
|
Antifungal agent 29 (compound 9d) is a potent, selective and non-toxic antifungal agent. Antifungal agent 29 shows antifungal activity towards Cryptococcus neoformans (MIC ≤ 0.23 μM) .
|
-
- HY-W766368
-
C6-Cer-13C2,d2; N-Hexanoylsphingosine-13C2,d2
|
Isotope-Labeled Compounds
Apoptosis
|
Cancer
|
C6 Ceramide- 13C2,d2 (C6-Cer- 13C2,d2) is the deuterium labeled and 13C-labeled C6 Ceramide (HY-19542). C6 Ceramide (C6-Cer) is a short-chain, cell-permeable ceramide pathway activator with anticancer activity. C6 Ceramide-mediated miR-29b expression participates in the progression of multiple myeloma through suppressing the proliferation, migration and angiogenesis of endothelial cells by targeting Akt signal pathway. C6 Ceramide exhibits multiple anti-cancer properties including cell cycle arrest, Apoptosis, inhibition of tumor growth and enhances the effects of chemotherapy in drug-resistant cancer cells. C6-ceramide can be used as an adjuvant for chemotherapeutic agents, to enhance anti-tumor effects .
|
-
- HY-151093
-
-
-
-
HY-L172
-
|
111 compounds
|
Immunity refers to the ability of the body to resist the invasion of pathogenic microorganisms and resist a variety of diseases. Immunocompromised will inevitably lead to a series of diseases. Immunopotentiator are a class of compounds that enhance immune function and induce immune response. Immunopotentiator can activate the proliferation and differentiation of one or more kinds of immune active cells in the body, promote the secretion of lymphocytes, and then enhance the immune function of the body. Immunopotentiator are mainly used in the treatment of tumors, infectious diseases and immunodeficiency diseases. In addition, immunopotentiator are often used as adjuvants in combination with vaccine antigens to enhance the immunogenicity of vaccines.
MCE designs a unique collection of 111 compounds with definite or potential Immunopotentiating effect, mainly targeting the NOD-like Receptor (NLR), Toll-like Receptor (TLR), NF-κB, etc. It is an effective tool for development and research of anti-cancer, anti-infectious diseases and anti-immunodeficiency diseases compounds.
|
Cat. No. |
Product Name |
Type |
-
- HY-B1422
-
Aminacrine
|
Fluorescent Dyes/Probes
|
9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
- HY-107202GL
-
Poly(I:C) (GMP Like)
|
Fluorescent Dye
|
Polyinosinic-polycytidylic acid (Poly(I:C)) (GMP Like) is the GMP Like class Polyinosinic-polycytidylic acid (HY-107202), and can be used as pharmaceutical excipients. Polyinosinic-polycytidylic acid (Poly(I:C)) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid can directly trigger cancer cells to undergo apoptosis .
|
-
- HY-153209G
-
|
Fluorescent Dye
|
Adjuvant-4 (GMP) is a GMP grade Adjuvant-4. Adjuvant-4 is a vaccine adjuvant that enhances antigen-specific antibody titers and cytotoxic T lymphocyte (CTL) responses . Adjuvant is generally an oil-in-water emulsifier of mineral oil and mannitol monooleate.
|
-
- HY-160198G
-
|
Fluorescent Dye
|
Vaccine adjuvant-1 GMP is Vaccine adjuvant-1 produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Vaccine adjuvant-1 is an vaccine adjuvant is a vaccine adjuvant containing an oil phase, emulsifying agent and water .
|
-
- HY-160197G
-
|
Fluorescent Dye
|
Aluminum phosphate adjuvant GMP is a Aluminum phosphate adjuvant produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
|
-
- HY-B1422R
-
Aminacrine (Standard)
|
Fluorescent Dyes/Probes
|
9-Aminoacridine (Standard) is the analytical standard of 9-Aminoacridine. This product is intended for research and analytical applications. 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
- HY-111582G
-
|
Fluorescent Dye
|
BBIQ (GMP) is BBIQ (HY-111582) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. BBIQ is a potent and selectively toll-like receptor 7 (TLR7) agonist with an EC50 of 59.1 nM. BBIQ is a powerful vaccine adjuvant that enhances innate immune responses .
|
-
- HY-156087G
-
|
Fluorescent Dye
|
Cholicamideβ (GMP) is a GMP grade of Cholicamideβ. Cholicamideβ (compound 6) is a self-assembling, small molecule, cancer vaccine adjuvant. Cholicamideβ can form virus-like particles with low cytotoxicity. Cholicamideβ, upon binding to peptide antigens, enhances antigen presentation by dendritic cells and induces antigen-specific T cells. Cholicamideβ can induce apoptosis and necrosis .
|
-
- HY-12273G
-
|
Fluorescent Dye
|
DMH-1 (GMP) is a GMP-grade version of DMH-1 (HY-12273). Small molecules of GMP grade can be used as adjuvant reagents in cell therapy. DMH-1 (GMP) promotes cardiac differentiation in mouse embryonic stem cells. DMH-1 (GMP) promotes neurogenesis of hiPSCs. DMH-1 is a potent and selective BMP inhibitor .
|
-
- HY-141432G
-
Cbl-b-IN-3 (GMP)
|
Fluorescent Dye
|
NX-1607 (Cbl-b-IN-3) (GMP) is a GMP-grade NX-1607 (HY-141432). GMP-grade small molecules can be used as adjuvant agents in cell therapy. NX-1607 (GMP) enhances antigen recall, reduces T cell exhaustion and increases cytokine production. NX-1607 is an inhibitor of Cbl-b (an E3 enzyme) .
|
-
- HY-15001G
-
SR1 (GMP)
|
Fluorescent Dye
|
Stemregenin 1 (SR1) (GMP) is a GMP-grade Stemregenin 1 (HY-15001). GMP-grade small molecules can be used as adjuvants in cell therapy. Stemregenin 1 is a potent aryl hydrocarbon receptor (AhR) antagonist with an IC50 of 127 nM. Stemregenin 1 (GMP) can competitively bind to AhR and inhibit its nuclear translocation, inhibiting osteoclastogenesis and promoting hematopoietic progenitor cell expansion by blocking the AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway. Stemregenin 1 (GMP) can be used for the treatment of osteoporosis, in vitro expansion of hematopoietic stem cells, and the study of the mechanism of bone metabolic diseases .
|
Cat. No. |
Product Name |
Type |
-
- HY-142998
-
|
Drug Delivery
|
Vaxfectin is a second-generation cationic lipid-based suspension that adjuvants effectively both pDNA and protein-based vaccines. Vaxfectin can boost the immune response against a range of pDNA-expressed pathogenic antigens in vivo. Vaxfectin can increase IgG titers and give rise to an IL-6 dependent enhancement of the humoral immune response without altering the Th1 type immune response. Vaxfectin can be studied for vaccine formulation .
|
-
- HY-B2241A
-
Aluminum potassium sulfate dodecahydrate, for cell culture
|
Cell Assay Reagents
|
Potassiumalum, for cell culture (Aluminum potassium sulfate dodecahydrate, for cell culture) is an egg white adjuvant that can induce allergic reactions in mice; it can also be used for bacterial staining. Potassiumalum, for cell culture is a biomaterial or organic compound that can be used in life science research .
|
-
- HY-153209G
-
|
Biochemical Assay Reagents
|
Adjuvant-4 (GMP) is a GMP grade Adjuvant-4. Adjuvant-4 is a vaccine adjuvant that enhances antigen-specific antibody titers and cytotoxic T lymphocyte (CTL) responses . Adjuvant is generally an oil-in-water emulsifier of mineral oil and mannitol monooleate.
|
-
- HY-160198G
-
|
Biochemical Assay Reagents
|
Vaccine adjuvant-1 GMP is Vaccine adjuvant-1 produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Vaccine adjuvant-1 is an vaccine adjuvant is a vaccine adjuvant containing an oil phase, emulsifying agent and water .
|
-
- HY-160197G
-
|
Biochemical Assay Reagents
|
Aluminum phosphate adjuvant GMP is a Aluminum phosphate adjuvant produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
|
-
- HY-144002
-
RC-529
|
Drug Delivery
|
RIBI-529 (RC-529), a lipid A mimetic (aminoalkyl glucosaminide 4-phosphate), is a adjuvant with a similar efficacy to MPL (Corixa). RIBI-529 signals through Toll-like receptor 4 to stimulate the innate immune system .
|
-
- HY-161561
-
|
Biochemical Assay Reagents
|
PROMETON/OVA is an antigen-adjuvant conjugate formed by the coupling of PROMETON and ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and enhances cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161583
-
|
Biochemical Assay Reagents
|
Marijuana/BSA is the antigen-adjuvant conjugate of Marijuana and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161562
-
|
Biochemical Assay Reagents
|
PROMETON/BSA is an antigen-adjuvant conjugate formed by the coupling of PROMETON with bovine serum albumin (BSA). By coupling the antigen to the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-156616
-
|
Drug Delivery
|
VC1052 is a dialkoxypropylammonium-based material and is the core cationic lipid component of the cationic lipid adjuvant Vaxfectin (HY-142998). Vaxfectin consists of VC1052 and lipid DPyPE (HY-112766) in a 1:1 molar ratio. Vaxfectin can be used as a vaccine adjuvant for the preparation of plasmid DNA and protein vaccines .
|
-
- HY-161529
-
|
Biochemical Assay Reagents
|
Angiotensin I/BSA is an antigen-adjuvant conjugate of Angiotensin I and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161549
-
|
Biochemical Assay Reagents
|
Phosphotyrosine/BSA is an antigen-adjuvant conjugate formed by coupling Phosphotyrosine with Bovine Serum Albumin (BSA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161553
-
|
Biochemical Assay Reagents
|
Biotin/KLH is an antigen-adjuvant conjugate that consists of Biotin and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163556
-
|
Biochemical Assay Reagents
|
COT/BSA is the antigen-adjuvant conjugate of COT (cyclooctatetraene) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161558
-
|
Biochemical Assay Reagents
|
Ractopamine/KLH is an antigen-adjuvant conjugate of Ractopamine (HY-113781) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161533
-
|
Biochemical Assay Reagents
|
Digoxin/BSA is an antigen-adjuvant conjugate of Digoxin (HY-B1049) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161542
-
|
Biochemical Assay Reagents
|
Isoniazid/BSA is an antigen-adjuvant conjugate of Isoniazid (HY-B0329) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161540
-
|
Biochemical Assay Reagents
|
Oxytetracycline/OVA is an antigen-adjuvant conjugate formed by the coupling of Oxytetracycline (HY-B0275) with ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, it enhances the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or destroy the major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163555
-
|
Biochemical Assay Reagents
|
BZO/BSA is an antigen-adjuvant conjugate formed by the coupling of BZO (benzodiazepine) with bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161555
-
|
Biochemical Assay Reagents
|
Clenbuterol/KLH is an antigen-adjuvant conjugate of Clenbuterol (HY-B1615) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161554
-
|
Biochemical Assay Reagents
|
Clenbuterol/BSA is an antigen-adjuvant conjugate of Clenbuterol (HY-B1615) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161566
-
|
Biochemical Assay Reagents
|
DHT/BSA is an antigen-adjuvant conjugate formed by the coupling of DHT (dihydrotestosterone) and bovine serum albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161532
-
|
Biochemical Assay Reagents
|
Eugenol/OVA is an antigen-adjuvant conjugate formed by the conjugation of Eugenol (HY-N0337) with Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161591
-
|
Biochemical Assay Reagents
|
SEM/BSA is an antigen-adjuvant conjugate formed by the conjugation of SEM (furanesalin) with bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161594
-
|
Biochemical Assay Reagents
|
Furazolidone/BSA is the antigen-adjuvant conjugate of Furazolidone (HY-B1336) and bovine serum albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161530
-
|
Biochemical Assay Reagents
|
Angiotensin II/BSA is an antigen-adjuvant conjugate formed by the coupling of Angiotensin II with bovine serum albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163553
-
|
Biochemical Assay Reagents
|
Metronidazole/BSA is an antigen-adjuvant conjugate of Metronidazole (HY-B0318) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161557
-
|
Biochemical Assay Reagents
|
Ractopamine/BSA is an antigen-adjuvant conjugate formed by the conjugation of Ractopamine (HY-113781) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161590
-
|
Biochemical Assay Reagents
|
AHD/BSA is the antigen-adjuvant conjugate of AHD (furan-2-carboxylic acid) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy the main epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161586
-
|
Biochemical Assay Reagents
|
Chloramphenicol/BSA is the antigen-adjuvant conjugate formed by the coupling of Chloramphenicol (HY-B0239) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161546
-
|
Biochemical Assay Reagents
|
Melamine/KLH is an antigen-adjuvant conjugate formed by coupling Melamine (HY-Y1117) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the primary epitopes, and can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161547
-
|
Biochemical Assay Reagents
|
Tetracycline/BSA is an antigen-adjuvant conjugate formed by the conjugation of Tetracycline (HY-A0107) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it enhances cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161535
-
|
Biochemical Assay Reagents
|
Oxytetracycline/BSA is an antigen-adjuvant conjugate formed by the coupling of Oxytetracycline (HY-B0275) with Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-161580
-
|
Biochemical Assay Reagents
|
3-Nitrotyrosine/BSA is an antigen-adjuvant conjugate formed by the conjugation of 3-Nitrotyrosine with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it enhances cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161528
-
|
Biochemical Assay Reagents
|
T3/OVA is an antigen-adjuvant conjugate formed by conjugating T3 (thyroxine) with ovalbumin (OVA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161560
-
|
Biochemical Assay Reagents
|
Tacrolimus/BSA is the antigen-adjuvant conjugate formed by the conjugation of Tacrolimus (HY-13756) with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161541
-
|
Biochemical Assay Reagents
|
Estradiol/BSA is the antigen-adjuvant conjugate formed by the coupling of Estradiol (HY-B0141) with Bovine Serum Albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161589
-
|
Biochemical Assay Reagents
|
GABA/KLH is an antigen-adjuvant conjugate formed by the coupling of GABA (γ-aminobutyric acid) with keyhole limpet hemocyanin (KLH). By coupling the antigen with a protein adjuvant, it can enhance the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161534
-
|
Biochemical Assay Reagents
|
Sulfadiazine/BSA is an antigen-adjuvant conjugate formed by the conjugation of Sulfadiazine (HY-B0273) with Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161552
-
|
Biochemical Assay Reagents
|
T3/BSA is an antigen-adjuvant conjugate of T3 (thyroid hormone) and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161588
-
|
Biochemical Assay Reagents
|
GABA/BSA is an antigen-adjuvant conjugate formed by the coupling of GABA (γ-aminobutyric acid) with Bovine Serum Albumin (BSA). By coupling the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161559
-
|
Biochemical Assay Reagents
|
Sudan I/OVA is an antigen-adjuvant conjugate formed by coupling Sudan I (HY-D0024) with Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the main epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161585
-
|
Biochemical Assay Reagents
|
Diethylstilbestrol/KLH is an antigen-adjuvant conjugate formed by the coupling of Diethylstilbestrol (HY-14598) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-163551
-
|
Biochemical Assay Reagents
|
The BNP peptide/KLH is an antigen-adjuvant conjugate formed by linking BNP peptide (human brain natriuretic peptide) with keyhole limpet hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or damage the major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161545
-
|
Biochemical Assay Reagents
|
Sudan I/BSA is the antigen-adjuvant conjugate formed by Sudan I (HY-D0024) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161556
-
|
Biochemical Assay Reagents
|
Alginic acid/KLH is an antigen-adjuvant conjugate formed by the coupling of Alginic acid (HY-W127758) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161526
-
|
Biochemical Assay Reagents
|
T3/KLH is an antigen-adjuvant conjugate formed by the coupling of T3 (thyroid hormone) with keyhole limpet hemocyanin (KLH). By coupling the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161584
-
|
Biochemical Assay Reagents
|
Sudan I/KLH is an antigen-adjuvant conjugate formed by the coupling of Sudan I (HY-D0024) with Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
-
- HY-161565
-
|
Biochemical Assay Reagents
|
Gastrin(1-17)/BSA is an antigen-adjuvant conjugate formed by the coupling of Gastrin(1-17) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
-
- HY-163552
-
|
Biochemical Assay Reagents
|
Prostaglandin F2a/BSA is an antigen-adjuvant conjugate formed by the conjugation of Prostaglandin F2a with Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation as well as the generation of antigen-specific T cells.
|
- HY-161563
-
|
Biochemical Assay Reagents
|
4,4'-Sulfonyldiphenol/BSA is the antigen-adjuvant conjugate of 4,4'-Sulfonyldiphenol (HY-W011927) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
- HY-161551
-
|
Biochemical Assay Reagents
|
25-OH Vitamin D3/KLH is an antigen-adjuvant conjugate of 25-OH Vitamin D3 (HY-158285) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-W782032
-
3D-MPLA-5
|
Drug Delivery
|
3D-Monophosphoryl Lipid A-5 (3D-MPLA-5) is a TLR agonist that can be used as an adjuvant for vaccines to enhance their immunogenicity .
|
- HY-NP141
-
4-Hydroxy-3-nitrophenylacetyl-bovine serum albumin
|
Native Proteins
|
NP-BSA (4-Hydroxy-3-nitrophenylacetyl-bovine serum albumin) is an antigen-adjuvant conjugate of 4-Hydroxy-3-nitrophenylacetyl (NP) conjugated to bovine serum albumin (BSA), which is an immune complex. By conjugating antigens to protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and can enhance cross-presentation and the generation of antigen-specific T cells .
|
- HY-D1005A23
-
PEG-PPG-PEG, 4400 (Averag)
|
Co-solvents
|
Poloxamer 401 L121 is block polymer of polyoxyethylene and polyoxypropylene. Poloxamer 401 L121 is utilized as lymphotrophic particles in nanoparticle engineering, as inhibitor of multidrug resistance and adjuvant activities or as surfactants and emulsifying agents in cosmetics .
|
- HY-144016
-
|
Drug Delivery
|
16:0 EPC chloride, a P-O-ethyl derivative, is a saturated cationic lipid. 16:0 EPC chloride can serve as a DNA and RNA transfecting agent. 16:0 EPC chloride can be used as a co-adjuvant for preparing vaccines and promote drug delivery .
|
- HY-D1056B4
-
LPS, from bacterial (Salmonella typhosa)
|
Carbohydrates
|
Lipopolysaccharides, from Salmonella typhosa are lipopolysaccharide endotoxins and TLR-4 activators derived from Salmonella typhosa, classified as S-type LPS, which can activate pathogen-associated molecular patterns (PAMP) of the immune system and induce cellular secretion of migrasomes. Lipopolysaccharides, from Salmonella typhosa exhibit a typical three-part structure: O-antigen, core oligosaccharide, and lipid A. Lipopolysaccharides, from Salmonella typhosa can serve as vaccine adjuvants and demonstrate adjuvant activity targeting B cells in immune responses in vivo .
It is recommended to prepare a stock solution of ≥2 mg/mL and ensure that it is fully mixed and dissolved. Due to the adsorption characteristics of LPS, low adsorption centrifuge tubes should be used for aliquoting and storage.
|
- HY-W009722
-
Ditiocarb sodium trihydrate
|
Chelators
|
Sodium diethylcarbamodithioate (Ditiocarb sodium) trihydrate is a copper reagent. The reaction with Cu 2+ solution resulted in the formation of a complex, which increased the copper displacement precipitation rate. Sodium diethylcarbamodithioate trihydrate can reduce HIV infection and can be used in adjuvant immune research of high-risk breast cancer .
|
- HY-161544
-
|
Biochemical Assay Reagents
|
Cholyglycine/BSA is a conjugate of Cholyglycine and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
- HY-B1250
-
|
Biochemical Assay Reagents
|
Acedoben is a biochemical agent. Acedoben and iron ions can construct a fast self-assembled coordination complex. The Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
- HY-B1250A
-
|
Cell Assay Reagents
|
Acedoben sodium is the sodium salt form of Acedoben. Acedoben and iron ions can construct a rapidly self-assembled coordination complex, and the Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
- HY-161543
-
|
Biochemical Assay Reagents
|
DHT/KLH is a conjugate of DHT (dihydrotestosterone) and keyhole limpet hemocyanin (KLH). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt linear epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-161587
-
|
Biochemical Assay Reagents
|
Chloramphenicol/OVA is a conjugate of Chloramphenicol (HY-B0239) and Ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the production of antigen-specific T cells.
|
- HY-161581
-
|
Biochemical Assay Reagents
|
Metronidazole/OVA is a conjugate of Metronidazole (HY-B0318) and Ovalbumin (OVA). By conjugating the antigen with protein adjuvants, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt the primary epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-161548
-
|
Biochemical Assay Reagents
|
Metronidazole/KLH is a conjugate of Metronidazole (HY-B0318) and Keyhole Limpet Hemocyanin (KLH). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes and can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-161531
-
|
Biochemical Assay Reagents
|
Diethylstilbestrol/BSA is a conjugate of Diethylstilbestrol (HY-14598) and Bovine Serum Albumin (BSA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
- HY-163550
-
|
Biochemical Assay Reagents
|
5-MethylCytosine/BSA is a conjugate of 5-MethylCytosine (HY-W008091) and Bovine Serum Albumin (BSA). By conjugating the antigen with the protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or destroy key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-111582G
-
|
Biochemical Assay Reagents
|
BBIQ (GMP) is BBIQ (HY-111582) produced by using GMP guidelines. GMP small molecules works appropriately as an auxiliary reagent for cell therapy manufacture. BBIQ is a potent and selectively toll-like receptor 7 (TLR7) agonist with an EC50 of 59.1 nM. BBIQ is a powerful vaccine adjuvant that enhances innate immune responses .
|
- HY-W009722A
-
Ditiocarb sodium trihydrate, ACS, 99.0%
|
Chelators
|
Sodium diethylcarbamodithioate trihydrate, ACS, 99.0% (Ditiocarb sodium trihydrate, ACS, 99.0%) is a copper reagent. The reaction with Cu 2+ solution resulted in the formation of a complex, which increased the copper displacement precipitation rate. Sodium diethylcarbamodithioate trihydrate, ACS, 99.0% can reduce HIV infection and can be used in adjuvant immune research of high-risk breast cancer .
|
- HY-B1250R
-
|
Biochemical Assay Reagents
|
Acedoben (Standard) is the analytical standard of Acedoben. This product is intended for research and analytical applications. Acedoben is a biochemical agent. Acedoben and iron ions can construct a fast self-assembled coordination complex. The Fe-Ace coordination complex can not only serve as a carrier of tumor antigens, but also enhance antigen-specific anti-tumor immunity due to its inherent adjuvant properties .
|
- HY-156087G
-
|
Biochemical Assay Reagents
|
Cholicamideβ (GMP) is a GMP grade of Cholicamideβ. Cholicamideβ (compound 6) is a self-assembling, small molecule, cancer vaccine adjuvant. Cholicamideβ can form virus-like particles with low cytotoxicity. Cholicamideβ, upon binding to peptide antigens, enhances antigen presentation by dendritic cells and induces antigen-specific T cells. Cholicamideβ can induce apoptosis and necrosis .
|
- HY-12273G
-
|
Biochemical Assay Reagents
|
DMH-1 (GMP) is a GMP-grade version of DMH-1 (HY-12273). Small molecules of GMP grade can be used as adjuvant reagents in cell therapy. DMH-1 (GMP) promotes cardiac differentiation in mouse embryonic stem cells. DMH-1 (GMP) promotes neurogenesis of hiPSCs. DMH-1 is a potent and selective BMP inhibitor .
|
- HY-141432G
-
Cbl-b-IN-3 (GMP)
|
Biochemical Assay Reagents
|
NX-1607 (Cbl-b-IN-3) (GMP) is a GMP-grade NX-1607 (HY-141432). GMP-grade small molecules can be used as adjuvant agents in cell therapy. NX-1607 (GMP) enhances antigen recall, reduces T cell exhaustion and increases cytokine production. NX-1607 is an inhibitor of Cbl-b (an E3 enzyme) .
|
- HY-161525
-
|
Biochemical Assay Reagents
|
1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid linker/BSA is the conjugate of 1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid linker and bovine serum albumin (BSA). By conjugating the antigen with a protein adjuvant, it enhances the production of antigen-specific antibodies in vaccine models. The conjugate does not affect protein folding or disrupt key epitopes, and it can enhance cross-presentation and the generation of antigen-specific T cells.
|
- HY-161527
-
|
Biochemical Assay Reagents
|
1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid-OVA is a conjugate of 1-(2-Aminoethyl)-1H-pyrazol-4-ylphosphonic acid and ovalbumin (OVA). By conjugating the antigen with a protein adjuvant, the production of antigen-specific antibodies in vaccine models can be enhanced. The conjugate does not affect protein folding or disrupt major epitopes, and it can enhance cross-presentation and the production of antigen-specific T cells.
|
- HY-107202GL
-
Poly(I:C) (GMP Like)
|
Biochemical Assay Reagents
|
Polyinosinic-polycytidylic acid (Poly(I:C)) (GMP Like) is the GMP Like class Polyinosinic-polycytidylic acid (HY-107202), and can be used as pharmaceutical excipients. Polyinosinic-polycytidylic acid (Poly(I:C)) is a synthetic analog of double-stranded RNA and an agonist of toll-like receptor 3 (TLR3) and retinoic acid inducible gene I (RIG-I)-like receptors (RIG-I and MDA5). Polyinosinic-polycytidylic acid can be used as a vaccine adjuvant to enhance innate and adaptive immune responses, and to alter the tumor microenvironment. Polyinosinic-polycytidylic acid can directly trigger cancer cells to undergo apoptosis .
|
- HY-15001G
-
SR1 (GMP)
|
Biochemical Assay Reagents
|
Stemregenin 1 (SR1) (GMP) is a GMP-grade Stemregenin 1 (HY-15001). GMP-grade small molecules can be used as adjuvants in cell therapy. Stemregenin 1 is a potent aryl hydrocarbon receptor (AhR) antagonist with an IC50 of 127 nM. Stemregenin 1 (GMP) can competitively bind to AhR and inhibit its nuclear translocation, inhibiting osteoclastogenesis and promoting hematopoietic progenitor cell expansion by blocking the AhR-c-src-NF-κB/p-ERK MAPK-NFATc1 signaling pathway. Stemregenin 1 (GMP) can be used for the treatment of osteoporosis, in vitro expansion of hematopoietic stem cells, and the study of the mechanism of bone metabolic diseases .
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P1771A
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
OVA G4 peptide TFA is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-113064
-
|
Endogenous Metabolite
|
Cancer
|
Selenocystine is a broad-spectrum anti-cancer agent. Selenocystine induces DNA damage in HepG2 cells, particularly in the form of DNA double strand breaks (DSBs). Selenocystine exhibits great promise as a therapeutic or adjuvant agent targeting DNA repair for cancer treatment .
|
-
- HY-P1439
-
RS 09
Maximum Cited Publications
11 Publications Verification
|
Toll-like Receptor (TLR)
NF-κB
|
Inflammation/Immunology
|
RS 09 is an LPS (HY-D1056) peptide mimic and TLR4 agonist. RS 09 can bind to TLR-4 and activate NF-κB. RS 09 can function as an adjuvant in vivo, enhancing the antigen-specific immune response .
|
-
- HY-P1439A
-
RS 09 TFA
Maximum Cited Publications
11 Publications Verification
|
Toll-like Receptor (TLR)
NF-κB
|
Inflammation/Immunology
|
RS 09 TFA is an LPS (HY-D1056) peptide mimic and TLR4 agonist. RS 09 TFA can bind to TLR-4 and activate NF-κB. RS 09 TFA can function as an adjuvant in vivo, enhancing the antigen-specific immune response .
|
-
- HY-P4191A
-
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P10686
-
|
EGFR
|
Cancer
|
CH401 peptide is a HER2-derived antigen peptide. After being bound to the artificial viral capsid by a self-assembled β-cyclic peptide, CH401 peptide is encapsulated in a lipid bilayer containing the lipid adjuvant α-GalCer, and can be studied as a self-adjuvant anti-breast cancer vaccine candidate .
|
-
- HY-113893
-
|
Peptides
|
Inflammation/Immunology
|
β-Interleukin I (163-171), human, an immunostimulatory fragment of human IL-1β peptide, is a T cell activator. β-Interleukin I (163-171), human is not an IL-1R-binding domain of IL-1β. β-Interleukin I (163-171), human is a potent adjuvant that enhances the immune response in a variety of exptl. situations .
|
-
- HY-P1771
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
|
OVA G4 peptide is a variant of the agonist ovalbumin (OVA) peptide SIINFEKL (257-264). SIINFEKL is routinely used to stimulate ovalbumin-specific T cells and to test new vaccine adjuvants can form a stable hydrogel .
|
-
- HY-148663
-
Tripalmitoyl pentapeptide
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
Mitogenic Pentapeptide (Tripalmitoyl pentapeptide) is an effective activator of B lymphocyte mitogen and polyclonal. Mitogen Pentapeptide is a synthetic N-terminal analog of E. coli outer membrane lipoproteins (cysteinyl-seryl-seryl-asparaginyl-alanine). Mitogenic Pentapeptide can be used for the study of immune adjuvants .
|
-
- HY-P4191
-
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P10701
-
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
Q11 peptide is a β-sheet-forming peptide that plays an important role in self-assembly and targeted applications. As a scaffold peptide, Q11 peptide can display immunogenic epitopes and is widely used in peptide-based immune vaccine research. Additionally, Q11 peptide can be conjugated with MUC1 glycopeptides for the study of self-assembling, adjuvant-free MUC1 glycopeptide vaccines. Q11 peptide holds great potential for research in the field of cancer immunology .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-N7819S
-
|
Pristane-d40 is the deuterium labeled Pristane . Pristane (Norphytane) is a naturally occurring hydrocarbon oil found in small quantities in many plants, in various marine organisms, and as the most active component of mineral oil . Pristane is a non-antigenic adjuvant, and induces MHC class II-restricted, arthritogenic T cells in the rat .
|
-
-
- HY-19542S1
-
|
C6 Ceramide-d11 is deuterated labeled C6 Ceramide (HY-19542). C6-ceramide, a ceramide pathway activator, shows activity against a variety of cancer cell lines. C6-ceramide can be used as an adjuvant for chemotherapeutic agents, to enhance anti-tumor effects .
|
-
-
- HY-126363S
-
|
Ditiocarb-d10 (Diethyldithiocarbamic acid-d10) is the deuterium labeled Ditiocarb (HY-126363) . Ditiocarb (Diethyldithiocarbamic acid) is an accelerator of the rate of copper cementation. Ditiocarb (Diethyldithiocarbamic acid) reduces the incidence of HIV infection, and also enhances adjuvant immunoresearch of high risk breast cancer .
|
-
-
- HY-W766751
-
|
Folitixorin-d4 (5,10-Methylenetetrafolate-d4; ANX-510 (free acid)-d4) is the deuterium labeled Folitixorin (HY-14769). Folitixorin (5,10-methylenetetrahydrofolate) is a cofactor and an analog of leucovorin. Folitixorin is a promising agent for modulation of 5-FU cytotoxicity in adjuvant cancer research .
|
-
-
- HY-B1138S
-
|
Fenbufen-d9 (CL-82204-d9) is the deuterium labeled Fenbufen. Fenbufen (CL-82204) is an orally active non-steroidal anti-inflammatory drug (NSAID), with antipyretic effects. Fenbufen has potent activity in a variety of animal model, including carageenin edema, UV erythema and adjuvant arthritis. Fenbufen has inhibitory activities against COX-1 and COX-2 with IC50s of 3.9 μM and 8.1 μM, respectively. Fenbufen is a caspases (caspase-1, 3, 4, 5, 9) inhibitor .
|
-
-
- HY-B1422S
-
|
9-Aminoacridine-13C6 is the 13C-labeled 9-Aminoacridine(HY-B1422). 9-Aminoacridine, a fluorescent probe, acts as an indicator of pH for quantitative determination of transmembrane pH gradients (inside acidic). 9-Aminoacridine is an antimicrobial. 9-Aminoacridine exerts its antimicrobial activity by interacting with specific bacterial DNA and disrupting the proton motive force in K. pneumoniae. 9-Aminoacridine is a HIV-1 inhibitor and inhibits HIV LTR transcription highly dependent on the presence and location of the amino moiety. 9-Aminoacridine inhibits virus replication in HIV-1 infected cell lines. 9-Aminoacridine is used as a Rifampin (RIF; HY-B0272) adjuvant for the multidrug-resistant K. pneumoniae infections .
|
-
-
- HY-W766368
-
|
C6 Ceramide- 13C2,d2 (C6-Cer- 13C2,d2) is the deuterium labeled and 13C-labeled C6 Ceramide (HY-19542). C6 Ceramide (C6-Cer) is a short-chain, cell-permeable ceramide pathway activator with anticancer activity. C6 Ceramide-mediated miR-29b expression participates in the progression of multiple myeloma through suppressing the proliferation, migration and angiogenesis of endothelial cells by targeting Akt signal pathway. C6 Ceramide exhibits multiple anti-cancer properties including cell cycle arrest, Apoptosis, inhibition of tumor growth and enhances the effects of chemotherapy in drug-resistant cancer cells. C6-ceramide can be used as an adjuvant for chemotherapeutic agents, to enhance anti-tumor effects .
|
-
Cat. No. |
Product Name |
|
Classification |
-
- HY-159100
-
|
|
Azide
|
PVP-037 is a potent TLR7 and TLR8 agonist adjuvant. PVP-037 shows broad innate immune activation and enhances vaccine immune responses .
|
-
- HY-159102
-
|
|
Azide
|
PVP-037.2 is a TLR7/8 agonist. PVP-037.2 can serve as an adjuvant to enhance vaccine-induced TH1 type immune responses, increasing the production of antigen-specific antibodies IgG1 and IgG2c .
|
Cat. No. |
Product Name |
|
Classification |
-
- HY-153205
-
|
|
Adjuvant
|
Aluminum hydroxide adjuvant is a vaccine adjuvant. Aluminum hydroxide adjuvant induces the differentiation of macrophages into a new type of mature, specialized antigen-presenting cells in vitro .
|
-
- HY-153808
-
|
|
Adjuvant
|
Complete Freund's adjuvant (CFA) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund to enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA) stimulates a strong and durable immune response and can be used to induce persistent inflammatory pain models in mice, experimental autoimmune myocarditis (EAM) models, and more. Incomplete Freund's adjuvant (IFA) (HY-153808A) is another type of Freund's Adjuvant that stimulates a weaker immune response .
|
-
- HY-153808A
-
Montanide ISA-51
|
|
Adjuvant
|
Incomplete Freund's adjuvant (IFA) (Montanide ISA-51) is an immunoadjuvant emulsified with antigen by its discoverer Jules T. Freund. Incomplete Freund's adjuvant (IFA) does not contain inactivated tuberculosis bacilli and consists of petroleum jelly containing lanolin. Incomplete Freund's adjuvant (IFA) induces high antibody titers and long-lasting effector T cell responses with no long-term effects on collagen disease, tumors, or death. Complete Freund's adjuvant (CFA) (HY-153808) is another type of Freund's Adjuvant that stimulates a stronger immune response .
|
-
- HY-153808B
-
|
|
Adjuvant
|
Complete Freund's adjuvant (CFA, 1 mg/ml) is an immunoadjuvant emulsified with antigen that can enhance an animal's immune response to an antigen. Complete Freund's adjuvant (CFA, 1 mg/ml) is also an inducer of the Th1 immune response and a ligand of TLRs. Complete Freund's adjuvant (CFA, 1 mg/ml) contains heat-killed inactive tuberculosis bacilli and consists of a paraffin oil-in-water emulsion. Complete Freund's adjuvant (CFA, 1 mg/ml) stimulates a strong and durable immune response and can be used to induce rheumatoid arthritis in rats, and more .
|
-
- HY-150743C
-
|
|
CpG ODNs
|
ODN 2395 sodium is a C class oligodeoxynucleotide and can be used as vaccine adjuvant. ODN 2395 sodium is also a TLR9 agonist. Sequence: 5'-tcgtcgttttcggcgc:gcgccg-3' .
|
-
- HY-150743
-
|
|
CpG ODNs
|
ODN 2395 is a C class oligodeoxynucleotide and can be used as vaccine adjuvant. ODN 2395 is also a TLR9 agonist. Sequence: 5'-tcgtcgttttcggcgc:gcgccg-3' .
|
-
- HY-150750A
-
|
|
CpG ODNs
|
ODN M362 sodium, a class C oligodeoxynucleotide, is a TLR-9 agonist and can be used as a vaccine adjuvant. ODN M362 sodium induces cancer cell apoptosis .
|
-
- HY-153209
-
|
|
Adjuvant
|
Adjuvant-4 is a vaccine adjuvant that enhances antigen-specific antibody titers and cytotoxic T lymphocyte (CTL) responses . Adjuvant is generally an oil-in-water emulsifier of mineral oil and mannitol monooleate.
|
-
- HY-160197
-
|
|
Adjuvant
|
Aluminum phosphate adjuvant is a safe and effective adjuvant that activates immune system and immune system-related pathways in monocytes .
|
-
- HY-160198
-
|
|
Adjuvant
|
Vaccine adjuvant-1 is an vaccine adjuvant is a vaccine adjuvant containing an oil phase, emulsifying agent and water .
|
-
- HY-150750
-
|
|
CpG ODNs
|
ODN M362, a class C oligodeoxynucleotide, is a TLR-9 agonist and can be used as a vaccine adjuvant. ODN M362 induces cancer cell apoptosis .
|
-
- HY-150219
-
CpG-ODN M326
|
|
CpG ODNs
|
ODN M326 (CpG-ODN M326) is a potent TLR9 agonist. ODN M326 induces the production of TNF. ODN M326 can be used as a vaccine adjuvant .
|
-
- HY-150724C
-
1018 ISS sodium
|
|
CpG ODNs
|
ODN 1018 sodium, an oligodeoxynucleotide, is a TLR-9 agonist. ODN 1018 sodium is also a synthetic immunostimulatory sequence that can be used as vaccine adjuvant. Sequence: 5′-TGACTGTGAACGTTCGAGATGA-3′ .
|
-
- HY-150724
-
1018 ISS
|
|
CpG ODNs
|
ODN 1018 (1018 ISS), an oligodeoxynucleotide, is a TLR-9 agonist. ODN 1018 is also a synthetic immunostimulatory sequence that can be used as vaccine adjuvant. Sequence: 5′-TGACTGTGAACGTTCGAGATGA-3′ .
|
-
- HY-142998
-
|
|
Cationic Lipids
|
Vaxfectin is a second-generation cationic lipid-based suspension that adjuvants effectively both pDNA and protein-based vaccines. Vaxfectin can boost the immune response against a range of pDNA-expressed pathogenic antigens in vivo. Vaxfectin can increase IgG titers and give rise to an IL-6 dependent enhancement of the humoral immune response without altering the Th1 type immune response. Vaxfectin can be studied for vaccine formulation .
|
-
- HY-150218
-
ODN 2006 sodium; ODN 7909 sodium; PF-3512676 sodium; CpG 7909 sodium
|
|
CpG ODNs
|
Agatolimod sodium (ODN 2006) is a class B CpG ODN and is a TLR9 agonist. Agatolimod sodium can be used as vaccine adjuvant. Agatolimod sodium can be used for the research of cancer. Sequence: 5’-TCGTCGTTTTGTCGTTTTGTCGTT-3’ .
|
-
- HY-150734A
-
|
|
CpG ODNs
|
ODN 2007 sodium, a class B CpG ODN (oligodeoxynucleotide), is a Toll-like receptor (TLR) ligand. ODN 2007 sodium can be used as an immunomodulator, vaccine adjuvant, and enhance immune responses in mammals, fish, and humans. ODN 2007 sequence: 5'-TCGTCGTTGTCGTTTTGTCGTT-3' .
|
-
- HY-150734
-
|
|
CpG ODNs
|
ODN 2007, a class B CpG ODN (oligodeoxynucleotide), is a Toll-like receptor (TLR) ligand. ODN 2007 can be used as an immunomodulator, vaccine adjuvant, and enhance immune responses in mammals, fish, and humans. ODN 2007 sequence: 5'-TCGTCGTTGTCGTTTTGTCGTT-3' .
|
-
- HY-111582
-
|
|
Adjuvant
|
BBIQ is a imidazoquinoline compound and a potent and selectively toll-like receptor 7 (TLR7) agonist with an EC50 of 59.1 nM for human TLR7. BBIQ is a powerful vaccine adjuvant that enhances innate immune responses .
|
-
- HY-150742A
-
|
|
CpG ODNs
|
ODN 2336 sodium is a A-Class CpG ODN (oligodeoxynucleotides), is a potent TLR9 agonist. ODN 2336 sodium induces the production of IFN-α. ODN 2336 sodium up-regulates the expression of IP-10 mRNA and IL-18 mRNA. ODN 2336 sodium can be used as adjuvant of vaccines .
|
-
- HY-150742
-
|
|
CpG ODNs
|
ODN 2336 is a A-Class CpG ODN (oligodeoxynucleotides), is a potent TLR9 agonist. ODN 2336 induces the production of IFN-α. ODN 2336 up-regulates the expression of IP-10 mRNA and IL-18 mRNA. ODN 2336 can be used as adjuvant of vaccines .
|
-
- HY-153879
-
|
|
Cationic Lipids
|
C12-TLRa is an ionized adjuvant lipid. C12-TLRa targets TLR7/8 receptors in endosomes. C12-TLRa enhances mRNA delivery as a structural component of LNPs. C12-TLRa enhances innate immune responses. C12-TLRa can be used for the research of SARS-CoV-2 mRNA vaccine .
|
-
- HY-150726
-
|
|
CpG ODNs
|
ODN 1668, a class B CpG ODN (oligodeoxynucleotide), is a TLR-9 agonist. ODN 1668 has strong immune regulatory properties, can enhance the level of antibody IgG2 subtype, promote the immune response of T cells and B cells, and can be used in the study of vaccine adjuvants. In addition, CpG ODN 1668 induces an antimicrobial immune response via a CaTLR9 dependent pathway in groupers. Sequence: 5'-tccatgacgttcctgatgct-3’ .
|
-
- HY-150726C
-
|
|
CpG ODNs
|
ODN 1668 sodium, a class B CpG ODN (oligodeoxynucleotide), is a TLR-9 agonist. ODN 1668 sodium has strong immune regulatory properties, can enhance the level of antibody IgG2 subtype, promote the immune response of T cells and B cells, and can be used in the study of vaccine adjuvants. In addition, CpG ODN 1668 sodium induces an antimicrobial immune response via a CaTLR9 dependent pathway in groupers. Sequence: 5'-tccatgacgttcctgatgct-3’ .
|
-
- HY-159746
-
|
|
Adjuvant
|
HS801 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159748
-
|
|
Adjuvant
|
M402 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159754
-
|
|
Adjuvant
|
HS201 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159753
-
|
|
Adjuvant
|
HS105 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159752
-
|
|
Adjuvant
|
HS103 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159749
-
|
|
Adjuvant
|
M902 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159743
-
|
|
Adjuvant
|
M101 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159751
-
|
|
Adjuvant
|
HS101 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159744
-
|
|
Adjuvant
|
M103 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159747
-
|
|
Adjuvant
|
M401 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159750
-
|
|
Adjuvant
|
M903 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-159745
-
|
|
Adjuvant
|
M107 is a vaccine adjuvant and a key component in vaccines. Adjuvants can be divided into immunostimulants and delivery systems. Adjuvants can not only enhance the intensity and durability of immune responses, but also affect the type of immune responses. On the one hand, immunostimulants promote the production of antigen signals and co-stimulatory signals by targeting Toll-like receptors (TLRs) and other pattern recognition receptors (PRRs), leading to the maturation and activation of antigen presenting cells (APCs), thereby enhancing adaptive immune responses; on the other hand, delivery systems are carrier materials that promote antigen delivery by prolonging the bioavailability of loaded antigens and targeting antigens to lymph nodes or APCs. Several common adjuvants include: saponins, TLRs agonists, polysaccharides, nanoparticles, cytokines, and mucosal adjuvants .
|
-
- HY-156616
-
|
|
Cationic Lipids
|
VC1052 is a dialkoxypropylammonium-based material and is the core cationic lipid component of the cationic lipid adjuvant Vaxfectin (HY-142998). Vaxfectin consists of VC1052 and lipid DPyPE (HY-112766) in a 1:1 molar ratio. Vaxfectin can be used as a vaccine adjuvant for the preparation of plasmid DNA and protein vaccines .
|
-
- HY-150219A
-
CpG-ODN M326 sodium
|
|
CpG ODNs
|
ODN M326 (CpG-ODN M326) sodium is a potent TLR9 agonist. ODN M326 sodium induces TNF production and serves as a vaccine adjuvant .
|
-
- HY-141420
-
|
|
Phospholipids
|
PtdIns-(3,4,5)-P3(1,2-dihexanoyl) ammonium (compound 850176) is a vaccine adjuvant that enhances the immune function of vaccines .
|
-
- HY-144016
-
|
|
Cationic Lipids
|
16:0 EPC chloride, a P-O-ethyl derivative, is a saturated cationic lipid. 16:0 EPC chloride can serve as a DNA and RNA transfecting agent. 16:0 EPC chloride can be used as a co-adjuvant for preparing vaccines and promote drug delivery .
|
-
- HY-150744A
-
|
|
CpG ODNs
|
ODN 24888 sodium is an guanine-modified inhibitory oligonucleotides (INH-ODN), shows potent inhibition on TLR7/TLR9-mediated signaling. ODN 24888 sodium impairs IFN-α level and NF-κB activation, inhibits IL-6 release. ODN 24888 sodium involves in immune and inflammatory responses, can be used as a vaccine adjuvant .
|
-
- HY-150744
-
|
|
CpG ODNs
|
ODN 24888 is an guanine-modified inhibitory oligonucleotides (INH-ODN), shows potent inhibition on TLR7/TLR9-mediated signaling. ODN 24888 impairs IFN-α level and NF-κB activation, inhibits IL-6 release. ODN 24888 involves in immune and inflammatory responses, can be used as a vaccine adjuvant .
|
-
- HY-156087
-
|
|
Adjuvant
|
Cholicamideβ (GMP) is a GMP grade of Cholicamideβ. Cholicamideβ (compound 6) is a self-assembling, small molecule, cancer vaccine adjuvant. Cholicamideβ can form virus-like particles with low cytotoxicity. Cholicamideβ, upon binding to peptide antigens, enhances antigen presentation by dendritic cells and induces antigen-specific T cells. Cholicamideβ can induce apoptosis and necrosis .
|
-
- HY-112766
-
|
|
Phospholipids
|
DPyPE is a neutral phosphatidylethanolamine lipid composed of a polyisoprene alkyl chain with two pyridine-containing phosphine ligands. DPyPE is mainly used in liposome formulations and to enhance the efficiency of gene delivery in vitro and in vivo. For example, DPyPE can be mixed with cationic lipids such as VC1052 (HY-156616) (in a 1:1 ratio) to form the vaccine adjuvant Vaxfectin (HY-142998). DPyPE assists VC1052 in binding to negatively charged pDNA to form a uniform liposome complex by regulating the fluidity and stability of the liposome membrane .
|
-
- HY-150725
-
|
|
CpG ODNs
|
ODN 1585 is a potent inducer of IFN and TNFα production. ODN 1585 is a potent stimulator of NK (natural killer) function. ODN 1585 increases CD8+ T-cell function, including the CD8+ T cell-mediated production of IFN-γ. ODN 1585 induces regression of established melanomas in mice. ODN 1585 can confer complete protection against malaria in mice. ODN 1585 can be used for acute myelogenous leukemia (AML) and malaria research. ODN 1585 can be used as a vaccine adjuvant .
|
-
- HY-150725C
-
|
|
CpG ODNs
|
ODN 1585 sodium is a potent inducer of IFN and TNFα production. ODN 1585 sodium is a potent stimulator of NK (natural killer) function. ODN 1585 sodium increases CD8+ T-cell function, including the CD8+ T cell-mediated production of IFN-γ. ODN 1585 sodium induces regression of established melanomas in mice. ODN 1585 sodium can confer complete protection against malaria in mice. ODN 1585 sodium can be used for acute myelogenous leukemia (AML) and malaria research. ODN 1585 sodium can be used as a vaccine adjuvant .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: