Search Result
Results for "
Neuropathic
" in MedChemExpress (MCE) Product Catalog:
1
Biochemical Assay Reagents
7
Isotope-Labeled Compounds
Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-100771
-
|
Indoleamine 2,3-Dioxygenase (IDO)
|
Cardiovascular Disease
|
PCC0208009 is a potent IDO inhibitor with an IC50 value of 4.52 nM in HeLa cell. PCC0208009 alleviates neuropathic pain and comorbidities by regulating synaptic plasticity of anterior cingulate cortex (ACC) and amygdala .
|
-
-
- HY-125079
-
-
-
- HY-131004
-
|
Cannabinoid Receptor
|
Neurological Disease
|
CB2R PAM is an orally active cannabinoid type-2 receptors (CB2Rs) positive allosteric modulator. CB2R PAM displays antinociceptive activity in vivo in an experimental mouse model of neuropathic pain .
|
-
-
- HY-100080
-
|
Sodium Channel
|
Neurological Disease
|
A-887826 is a potent, selective, oral bioavailable and voltage-dependent Na(v)1.8 sodium channel blocker with an IC50 of 11 nM . A-887826 attenuates neuropathic tactile allodynia in vivo .
|
-
-
- HY-110036
-
-
-
- HY-106186
-
-
-
- HY-12909
-
-
-
- HY-159113
-
|
MARK
|
Neurological Disease
|
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .
|
-
-
- HY-124382
-
|
TRP Channel
|
Neurological Disease
|
AS1928370 is a novel and central nervous system (CNS) penetrant TRPV1 antagonist and can prevent ligand-induced activation in vivo. AS1928370 is a promising agent for neuropathic pain treatment research .
|
-
-
- HY-113608
-
|
Adenosine Receptor
|
Neurological Disease
|
VCP171 is a potent adenosine A1 receptor (A1R) positive allosteric modulator (PAM). VCP171 is effective at decreasing excitatory synaptic currents in Lamina II of neuropathic pain model. VCP171 can be used for researching neuropathic pain .
|
-
-
- HY-12122
-
|
NO Synthase
|
Neurological Disease
|
AR-C102222 is a spirocyclic fluoropiperidine quinazoline selective iNOS inhibitor. AR-C102222 can be used for the research of neuropathic pain .
|
-
-
- HY-143263
-
|
FAAH
MAGL
|
Neurological Disease
|
FAAH/MAGL-IN-1 (compound SIH 3) is a potent FAAH and MAGL inhibitor with IC50s of 31 nM and 29 nM, respectively. FAAH/MAGL-IN-1 has the potential for the research of neuropathic pain .
|
-
-
- HY-103344
-
|
Aminopeptidase
mGluR
|
Neurological Disease
Inflammation/Immunology
|
ZJ43 is a potent NAAG peptidase inhibitor, with an IC50 of 2.4 nM and a Ki of 0.8 nM. ZJ43 sufficiently activates group II mGluR and reduces some of the behavioral effects of PCP. ZJ43 shows an analgesic effect in neuropathic and inflammatory and pain models .
|
-
-
- HY-14897
-
-
-
- HY-15451
-
MDA 19
1 Publications Verification
|
Cannabinoid Receptor
|
Neurological Disease
|
MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a Ki of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .
|
-
-
- HY-B0161E
-
(Rac)-Duloxetine hydrochloride
|
Serotonin Transporter
|
Neurological Disease
|
(±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research .
|
-
-
- HY-106010
-
|
Cannabinoid Receptor
|
Neurological Disease
|
LBP1 is an orally active and low brain penetrant CB1 receptor agonist. LBP1 exhibits significant anti-allodynic and anti-hyperalgesic effects in rodent models of neuropathic pain .
|
-
-
- HY-147306
-
|
NO Synthase
|
Neurological Disease
|
ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain. ZLc-002 can be used for the research of anxiety disorder and inflammation .
|
-
-
- HY-B0246
-
-
-
- HY-117714
-
|
Sodium Channel
|
Neurological Disease
|
AZD-3161 is a potent and selective blocker of NaV1.7 channel, with a pIC50 of 7.1. AZD-3161 can be used for the research of neuropathic and inflammatory pain .
|
-
-
- HY-162759
-
|
Sigma Receptor
|
Neurological Disease
|
Sigma-1 receptor antagonist 6 (Compound 12) is an antagonist of the Sigma-1 receptor (σ1R). Sigma-1 receptor antagonist 6 exerts a robust antiallodynic effect by antagonizing σ1R. Sigma-1 receptor antagonist 6 can be used in neuropathic pain animal models to alleviate mechanical allodynia induced by paclitaxel (HY-B0015) .
|
-
-
- HY-155616
-
|
Sigma Receptor
Histamine Receptor
|
Neurological Disease
|
KSK94 is a high-affinity histamine H3 receptor antagonist, with Kis of 7.9, 2958, 75.2 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK94 can be used for research of nociceptive and neuropathic pain .
|
-
-
- HY-132133
-
-
-
- HY-19636
-
|
FAAH
Autophagy
|
Neurological Disease
|
JNJ-42165279 is an orally active FAAH inhibitor, with IC50 values of 70 nM for hFAAH and 313 nM for rFAAH. JNJ-42165279 can be used in research related to the field of neuropathic pain .
|
-
-
- HY-143879
-
-
-
- HY-A0057
-
|
Calcium Channel
|
Neurological Disease
Cancer
|
Gabapentin is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .
|
-
-
- HY-A0057A
-
|
Calcium Channel
|
Neurological Disease
Cancer
|
Gabapentin hydrochloride is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .
|
-
-
- HY-155615
-
|
Sigma Receptor
Histamine Receptor
|
Neurological Disease
|
KSK67 is a high-affinity dual sigma-2 and histamine H3 receptor antagonist, with Kis of 3.2, 1531, 101 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK67 can be used for research of nociceptive and neuropathic pain .
|
-
-
- HY-161914
-
|
P2X Receptor
|
Neurological Disease
|
P2X3 antagonist 39 (compound 26a) is a selective P2X3 receptor antagonist with an IC50 value of 54.9 nM. P2X3 antagonist 39 can be used in the study of neuropathic pain model .
|
-
-
- HY-B0246R
-
|
Sodium Channel
Autophagy
Mitophagy
Potassium Channel
Calcium Channel
HDAC
|
Neurological Disease
Cancer
|
Carbamazepine (Standard) is the analytical standard of Carbamazepine. This product is intended for research and analytical applications. Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC50 of 131 μM. Carbamazepine blocks voltage gated Na +, Ca 2+, and K + channels, and is also a HDAC inhibitor (IC50: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .
|
-
-
- HY-14900
-
GRC-10693
|
Cannabinoid Receptor
|
Inflammation/Immunology
|
Tedalinab (GRC-10693) is a potent, orally active, and selective cannabinoid receptor 2 (CB2) agonist. Tedalinab has >4700-fold functional selectivity for CB2 over CB1. Tedalinab has potential for neuropathic pain and osteoarthritis treatment .
|
-
-
- HY-15451R
-
|
Cannabinoid Receptor
|
Neurological Disease
|
MDA 19 (Standard) is the analytical standard of MDA 19. This product is intended for research and analytical applications. MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a Ki of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .
|
-
-
- HY-143878
-
-
-
- HY-121239
-
|
NF-κB
|
Neurological Disease
Inflammation/Immunology
Cancer
|
Lemnalol is a potent agent for neuropathic pain. Lemnalol possesses potent anti-inflammatory, analgesic and anti-tumor activities. Lemnalol has the capacity to attenuate hyperalgesia and allodynia by modulation of neuroinflammatory processes in neuropathy. Lemnalol modulates LPS-induced alterations of left atrial (LA) calcium homeostasis and blocks the NF-κB pathways, which may contribute to the attenuation of lipopolysaccharide (LPS)-induced arrhythmogenesis and neuropathic pain. Lemnalolis a ylangene-type sesquiterpenoid compound, isolated from Lemnalia cervicorni .
|
-
-
- HY-117091
-
|
Opioid Receptor
|
Neurological Disease
Inflammation/Immunology
|
DDD-028 is a potent non-opioid, non-cannabinoid analgesic which attenuates neuropathic and inflammatory pain without the possible side effects or abuse potential associated with opioid or cannabinoid activities. DDD-028 can be utilized in analgesic research .
|
-
-
- HY-155614
-
|
Sigma Receptor
Histamine Receptor
|
Neurological Disease
|
KSK68 is a high-affinity dual sigma-1 and histamine H3 receptor antagonist, with Kis of 7.7, 3.6, 22.4 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK68 has negligible affinity at the other histamine receptor subtypes. KSK68 can be used for research of nociceptive and neuropathic pain .
|
-
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-156684
-
GDC-6599
|
TRP Channel
|
Neurological Disease
|
GDC-6599 is an orally active TRPA1 inhibitor, with IC50 values of 5.3 nM in humans, 6.6 nM in rats, 9.3 nM in dogs, 7.2 nM in monkeys, and 15 nM in guinea pigs. GDC-6599 can be used in the research of neuropathic pain and respiratory diseases such as asthma and chronic cough .
|
-
-
- HY-15078
-
(R)-SPD502
|
iGluR
|
Neurological Disease
|
NS1219 ((R)-SPD502) is the isomer of NS 1209 HY-15074. NS1209 is a selective AMPA receptor antagonist with neuroprotective activity. NS1209 can be used for the research of stroke, neuropathic pain and epilepsy .
|
-
-
- HY-A0057R
-
|
Calcium Channel
|
Neurological Disease
Cancer
|
Gabapentin (Standard) is the analytical standard of Gabapentin. This product is intended for research and analytical applications. Gabapentin is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .
|
-
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
-
- HY-143880
-
|
Mas-related G-protein-coupled Receptor (MRGPR)
|
Neurological Disease
|
MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC50 value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain .
|
-
-
- HY-144301
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-2 (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC50 of 5.8 nM. AAK1-IN-2 can be used for the research of neuropathic pain .
|
-
-
- HY-107656
-
|
mAChR
|
Neurological Disease
|
PTAC oxalate is a selective muscarinic receptor ligand. PTAC oxalate is an partial agonist of M2 and M4 but antagonist of M1, M3, and M5 (Ki values of 0.2-2.8 nM for hM1-5 in CHO cells). PTAC oxalate alleviates the mechanical allodynia on the neuropathic pain and has antidepression effects .
|
-
-
- HY-144301A
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-2 TFA (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC50 of 5.8 nM. AAK1-IN-2 TFA can be used for the research of neuropathic pain .
|
-
-
- HY-108449
-
WS-12; AR-15512; AVX-012
|
TRP Channel
|
Cancer
|
Acoltremon (WS-12; AR-15512) is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research .
|
-
-
- HY-133130
-
|
MAGL
|
Neurological Disease
|
JNJ-42226314 is a competitive, highly selective and reversible non-covalent monoacylglycerol lipase (MAGL) inhibitor. JNJ-42226314 demonstrates dose-dependent enhancement of the major endocannabinoid 2-arachidonoylglycerol (2-AG) as well as efficacy in models of neuropathic and inflammatory pain .
|
-
-
- HY-19876
-
Debio-0827
|
Opioid Receptor
Aminopeptidase
Neprilysin
|
Neurological Disease
Metabolic Disease
|
PL37 (Debio-0827) is an orally active Enkephalinase dual inhibitor (dual inhibition refers to the simultaneous inhibition of Neutral Endopeptidase and Aminopeptidase N activities). PL37 exerts its anti-hyperalgesic effects by activating μ-opioid receptors (µ-opioid receptors), with an ED50 value of 13.4 mg/kg for analgesic effects in mice. PL37 can be used to study diabetic neuropathic pain .
|
-
-
- HY-P1129
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
-
-
- HY-P0244
-
-
- HY-P0244A
-
-
- HY-16935
-
JNJ-39439335
|
TRP Channel
|
Neurological Disease
|
Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca 2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain .
|
-
- HY-129421
-
|
PACAP Receptor
|
Neurological Disease
Inflammation/Immunology
|
PA-9 is a pituitary adenylate cyclase-activating polypeptide (PACAP) type I (PAC1) receptor antagonist. PA-9 dose dependently inhibits PACAP-induced cAMP elevation with an IC50 of 5.6 nM. PA-9 can be used for the research of neuropathic and/or inflammatory pain .
|
-
- HY-158338
-
|
MAGL
|
Others
Neurological Disease
Inflammation/Immunology
Cancer
|
ABHD antagonist 1 possesses ABHD6 (α/β-Hydrolase domain containing 6) inhibitory activity, involving the regulation of biochemical pathways involved in ABHD6, thereby affecting cell function and inflammatory response. ABHD antagonist 1 can be used in pain, neuropathic diseases, inflammatory diseases. Autoimmune diseases, metabolic diseases, and cancer research .
|
-
- HY-133195
-
Fenazoxine
|
Sodium Channel
|
Neurological Disease
|
Nefopam (Fenazoxine) is an orally active, non-opioid and non-steroidal centrally acting analgesic agent. Nefopam blocks voltage-sensitive sodium channels (IC50=27 μM) and modulates glutamatergic transmission in rodents. Nefopam can be used in studies of neuropathic pain, anticonvulsant, as well as the prevention of postoperative shivering and hiccups .
|
-
- HY-119282
-
|
mGluR
|
Neurological Disease
|
AZD6538 is a potent, selective and brain penetrant mGluR5 negative allosteric modulator. AZD6538 inhibits DHPG (HY-12598A)-stimulated intracellular Ca2+ release in HEK cells expressing rat or human mGluR5, with IC50 values of 3.2 and 13.4 nM for rat mGluR5 and human mGluR5, respectively. AZD6538 can be used for the research of neuropathic pain .
|
-
- HY-110255
-
|
mGluR
Calcium Channel
Trk Receptor
|
Neurological Disease
|
AZD-2066 is a selective, orally active and blood-brain barrier-permeating mGluR5 antagonist. AZD 2066 activates the BDNF/trkB signaling pathway. AZD 2066 can be used in the research of neuropathic pain, major depressive disorder and gastroesophageal reflux disease .
|
-
- HY-110255A
-
|
mGluR
Calcium Channel
Trk Receptor
|
Neurological Disease
|
AZD-2066 hydrate is a selective, orally active and blood-brain barrier-permeating mGluR5 antagonist. AZD 2066 hydrate activates the BDNF/trkB signaling pathway. AZD 2066 hydrate can be used in the research of neuropathic pain, major depressive disorder and gastroesophageal reflux disease .
|
-
- HY-110255B
-
|
mGluR
Calcium Channel
Trk Receptor
|
Neurological Disease
|
AZD-2066 hydrochloride is a selective, orally active and blood-brain barrier-permeating mGluR5 antagonist. AZD 2066 hydrochloride activates the BDNF/trkB signaling pathway. AZD 2066 hydrochloride can be used in the research of neuropathic pain, major depressive disorder and gastroesophageal reflux disease .
|
-
- HY-P2150
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-P3618
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-164803
-
|
Calcium Channel
|
Inflammation/Immunology
|
CBD3063 is a selective modulator of collapsin response mediator protein 2 (CRMP2). CBD3063 uncouples Cav2.2 from CRMP2. CBD3063 reverses neuropathic and inflammatory pain by reducing membrane expression of CaV2.2 .
|
-
- HY-155183
-
|
Adenosine Receptor
|
Inflammation/Immunology
Cancer
|
A3AR agonist 1 (Compound 12) is an A3AR agonist (Ki: 25.8 nM). A3AR agonist 1 stimulates β-arrestin2 recruitment, with an EC50 value of 5.17 nM. A3AR agonist 1 can be used for research of inflammatory diseases, ischemia, cancer, neuropathic pain, liver diseases, etc .
|
-
- HY-143264
-
|
FAAH
MAGL
|
Neurological Disease
|
FAAH/MAGL-IN-2 is a potent, reversible, orally active, and cross the blood-brain barrier FAAH and MAGL inhibitor with IC50s of 11 nM and 36 nM (Kis of 28 nM and 60 nM), respectively . FAAH/MAGL-IN-2 has the potential to research neuropathic pain without causing locomotion impairment .
|
-
- HY-131019
-
|
mGluR
|
Neurological Disease
|
JF-NP-26, an inactive photocaged derivative of raseglurant, is the first caged mGlu5 receptor negative allosteric modulator. Uncaging of JF-NP-26 is elicited with light pulses in the visible spectrum (405 nm). JF-NP-26 induces light-dependent analgesia in models of inflammatory and neuropathic pain in freely behaving animals .
|
-
- HY-144302
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-3, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC50 of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research .
|
-
- HY-151392
-
|
LPL Receptor
|
Neurological Disease
Inflammation/Immunology
|
LPA5 antagonist 2 (compound 65) is a high aqueous solubility LPA5 (lysophosphatidic acid receptor 5) antagonist. LPA5 antagonist 2 significantly attenuates nociceptive hypersensitivity and it can be used for the research of inflammatory and neuropathic pains .
|
-
- HY-169808
-
|
mGluR
|
Neurological Disease
|
BOMA (Compound 7) is a potent and selective metabotropic glutamate receptor 5 (mGluR 5) antagonist with an IC50 value of 3 nM and an Ki value of 3 nM. BOMA is promising for research of various pain states, including acute, persistent and chronic pain, inflammatory pain and neuropathic pain .
|
-
- HY-144302A
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-3 TFA, a quinoline analogue, is a brain-penetrant adaptor protein 2-associated kinase 1 (AAK1) inhibitor with an IC50 of 11 nM. AAK1-IN-3 has the potential for neuropathic pain research .
|
-
- HY-125111
-
-
- HY-103111
-
|
mGluR
|
Neurological Disease
|
MMPIP hydrochloride is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (KB values 24 -30 nM). MMPIP hydrochloride acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP hydrochloride alleviates pain and normalizes affective and cognitive behavior in neuropathic mice .
|
-
- HY-107503
-
|
mGluR
|
Neurological Disease
|
MMPIP is an allosteric metabotropic glutamate receptor 7 (mGluR7) selective antagonist (KB values 24 -30 nM). MMPIP acts as a pharmacological tool for elucidating the roles of mGluR7 on central nervous system functions. MMPIP alleviates pain and normalizes affective and cognitive behavior in neuropathic mice .
|
-
- HY-136459
-
|
iGluR
|
Neurological Disease
|
NMDA receptor antagonist 2 is a potent and orally active NR2B subtype-selective NMDA antagonist with an IC50 and a Ki of 1.0 nM and 0.88 nM, respectively. NMDA receptor antagonist 2 is used for the study of neuropathic pain and Parkinson’s disease .
|
-
- HY-146280
-
|
GABA Receptor
|
Neurological Disease
Metabolic Disease
|
mGAT3/4-IN-1 (compound 19b) is a potent mGAT3/mGAT4 inhibitor, with pIC50 values of 5.31 and 5.24, respectively. mGAT3/4-IN-1 exhibits a significant tactile allodynia reduction in diabetic neuropathic mice .
|
-
- HY-145838
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-4 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC50 of 4.6 nM, Filt Ki of 0.9 nM, and cell IC50 of 8.6 nM). AAK1-IN-4 has the potential for the research for neuropathic pain .
|
-
- HY-145839
-
|
AAK1
|
Neurological Disease
|
AAK1-IN-5 is a highly selective, CNS-penetrable, and orally active adaptor protein-2-associated kinase 1 (AAK1) inhibitor (AAK1 IC50 of 1.2 nM, Filt Ki of 0.05 nM, and cell IC50 of 0.5 nM). AAK1-IN-4 has the potential for the research for neuropathic pain .
|
-
- HY-N2573A
-
L-Corydalmine hydrochloride; TLZ-16-CL
|
Fungal
CXCR
|
Infection
Neurological Disease
|
Corydalmine hydrochloride inhibits spore germination of some plant pathogenic as well as saprophytic fungi . Corydalmine hydrochloride acts as an oral analgesic agent, exhibiting potent analgesic activity . Corydalmine hydrochloride alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway .
|
-
- HY-151391
-
|
Biochemical Assay Reagents
|
Neurological Disease
|
LPA5 antagonist 1 (Compound 66) is a potent and selective lysophosphatidic acid receptor 5 (LPA5) antagonist (IC50=32 nM). LPA5 antagonist 1 shows high brain permeability and anti-nociceptive activity. LPA5 antagonist 1 can be used in inflammatory and neuropathic pain research . LPA5 antagonist 1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-143583
-
|
Phosphodiesterase (PDE)
|
Neurological Disease
Cancer
|
ATX inhibitor 10 is a potent inhibitor of ATX. ATX inhibitor 10 is s nitrogen-containing heterocyclic compound. ATX plays a role in causing pathological conditions including fibrosis, arthritis, neurodegeneration, neuropathic pain, and cancer. ATX inhibitor 10 has the potential for the research of ATX related diseases (extracted from patent WO2021115375A1, compound 35) .
|
-
- HY-118140
-
|
Cannabinoid Receptor
|
Neurological Disease
Inflammation/Immunology
|
ZCZ011 is a potent and brain penetrant cannabinoid 1 (CB1) receptor positive allosteric modulator. ZCZ011 potentiates binding of CP55,940 to the CB1 receptor, enhances anandamide (AEA)-stimulated GTPγS binding in mouse brain membranes. ZCZ011 increases β-arrestin recruitment and ERK phosphorylation in hCB1 cells. ZCZ011 can be used for researching neuropathic and inflammatory pain .
|
-
- HY-11079
-
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
Cancer
|
A-803467 is a potent and selective tetrodotoxin-resistant Nav1.8 sodium channel blocker (IC50=8 nM). A-803467 has shown significant anti-nociception in neuropathic and inflammatory pain models. A-803467 enhances the chemosensitivity of conventional anticancer agents through interaction with the ATP-binding cassette subfamily G member 2 (ABCG2) transporter .
|
-
- HY-127110
-
|
Phospholipase
|
Others
Neurological Disease
Inflammation/Immunology
|
AK106-001616 is a potent and selective inhibitor of cytosolic phospholipase A2 (cPLA2) (IC50=3.8 nmol/L). AK106-001616 is able to reduce the production of prostaglandins (PG) E2 and leukotrienes (LT) B4 by stimulated cells. AK106-001616 can be used in the study of inflammatory diseases, neuropathic pain and pulmonary fibrosis .
|
-
- HY-12844
-
|
Opioid Receptor
|
Neurological Disease
|
Ro 64-6198 is a potent, selective, nonpeptide, high-affinity, high cellular permeability and brain penetration N/OFQ receptor (NOP) agonist with an EC50 value of 25.6 nM. Ro 64-6198 is at least 100 times more selective for the NOP receptor over the classic opioid receptors. Ro 64-6198 can be used for stress and anxiety, addiction, neuropathic pain, cough, and anorexia .
|
-
- HY-168997
-
|
Cannabinoid Receptor
|
Neurological Disease
Inflammation/Immunology
|
CB1R agonist 1 (Compound '1350') is a potent full agonist of the cannabinoid-1 receptor (CB1R), with a Ki value of 0.95 nM. CB1R agonist 1 exhibits significant pain-reducing effects in multiple pain models, including acute heat pain, inflammatory pain, and neuropathic pain .
|
-
- HY-155417
-
|
ERK
Orphan Receptor
|
Neurological Disease
|
GPR34 receptor antagonist 3 (Compound 5e) is a class of GRP34 antagonists, IC50 is 0.680?μM. GPR34 receptor antagonist 3 inhibited ERK1/2 phosphorylation induced by lysophosphatidylserine in a dose-dependent way without obvious cytotoxicity. GPR34 receptor antagonist 3 shows antisensory activity in mouse neuropathic pain model .
|
-
- HY-110143
-
|
Potassium Channel
|
Neurological Disease
|
CLP257 is a selective K +-Cl ? cotransporter KCC2 activator with an EC50 of 616 nM. CLP257 is inactive against NKCC1, GABAA receptors, KCC1, KCC3 or KCC4. CLP257 restores impaired Cl ? transport in neurons with diminished KCC2 activity. CLP257 alleviates hypersensitivity in rats with neuropathic pain. CLP257 modulates plasmalemmal KCC2 protein turnover post-translationally .
|
-
- HY-B0563A
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacaine hydrochloride monohydrate is a potent?sodium channel?blocker and blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for regional anesthesia and neuropathic pain?management in vivo .
|
-
- HY-115681
-
6-Prenylnaringenin; (±)-6-Prenylnaringenin
|
Calcium Channel
|
Neurological Disease
|
(2R/S)-6-PNG (6-Prenylnaringenin) is a potent and reversible Cav3.2 T-type Ca 2+ channels (T-channels) blocker. (2R/S)-6-PNG can penetrate the blood-brain barrier (BBB). (2R/S)-6-PNG suppresses neuropathic and visceral pain in mice .
|
-
- HY-121333
-
|
Antibiotic
Wnt
β-catenin
|
Infection
Neurological Disease
Cancer
|
Dinactin, an antibiotic ionophore produced by Streptomyces species, as an effective small molecule targeting Wnt/β-catenin signaling pathway in cancer cells. Dinactin shows marked inhibition of HCT-116 cell growth with an IC50 of 1.1 µM. Dinactin shows anti-proliferative activity against the cancer cells in apoptosis-independent manner. Dinactin is also an effective agent for the research of neuropathic pain .
|
-
- HY-B0563
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is used for the research of neuropathic pain management .
|
-
- HY-B0563B
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacaine hydrochloride is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for neuropathic pain management in vivo .
|
-
- HY-155184
-
|
Adenosine Receptor
|
Neurological Disease
Inflammation/Immunology
Cancer
|
A3AR agonist 2 (Compound 19) a selective A3AR agonist (Ki: 22.1 nM). A3AR agonist 2 stimulates β-arrestin2 recruitment, with EC50 value of 4.36 nM. A3AR agonist 2 can be used for research of inflammatory diseases, ischemia, cancer, neuropathic pain, liver diseases, and other chronic conditions . A3AR agonist 2 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-103461
-
|
FAAH
|
Neurological Disease
|
FAAH-IN-6 (compound 21d) is a potent, orally active and cross the blood-brain barrier fatty acid amide hydrolase (FAAH) inhibitor with IC50s of 0.72, 0.28 nM for hFAAH, rFAAH, respectively. FAAH-IN-6 shows dose-dependent analgesic efficacy in animal models of both neuropathic and inflammatory pain .
|
-
- HY-144200
-
|
CCR
|
Neurological Disease
Cancer
|
CCR8 antagonist 2 is a potent antagonist of CCR8. CCR8 (C-C Motif Chemokine Receptor 8) is predominantly expressed on Treg cells and Th2 cells, but not on Th1 cells. CCR8 antagonist 2 inhibits CCR8 activity, which may be used in the research of diseases mediated by CCR8, such as cancer, and/or neuropathic pain (extracted from patent WO2022000443A1, compound 220) .
|
-
- HY-N5142
-
|
Bacterial
Antibiotic
NF-κB
AMPK
Fungal
|
Infection
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
α-Terpineol (with oral activity) can be found in Eucalyptus globulus Labill. α-Terpineol exhibits strong antimicrobial activity against periodontopathic and cariogenic bacteria.α-Terpineol possesses antifungal activity against T. mentagrophytes, and the activity might lead to irreversible cellular disruption. In addition, α-Terpineol exhibits antineuropathic and anti-inflammatory activities.
α-Terpineol can be utilized in research related to diarrhea, neuropathic pain, infections, and inflammation .
|
-
- HY-119521
-
KOE-1173
|
Sodium Channel
|
Cardiovascular Disease
Neurological Disease
|
Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research .
|
-
- HY-100822
-
(+)-HA-966
|
iGluR
|
Neurological Disease
|
(R)-(+)-HA-966 ((+)-HA-966) is a partial agonist/antagonist of glycine site of the N-methyl-D-aspartate (NMDA) receptor complex. (R)-(+)-HA-966 selectively blocks the activation of the mesolimbic dopamine system by amphetamine . (R)-(+)-HA-966 can cross the blood-brain barrier and has the potential for neuropathic and acute pain .
|
-
- HY-B0563C
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacaine mesylate is a long-acting amide local anaesthetic agent for a spinal block and effectively blocks neuropathic pain. Ropivacaine blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibressup>[1] . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel)?TREK-1?with an IC50?of 402.7 μM in COS-7 cell's membrane .
|
-
- HY-B0563AR
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacaine (hydrochloride monohydrate) (Standard) is the analytical standard of Ropivacaine (hydrochloride monohydrate). This product is intended for research and analytical applications. Ropivacaine hydrochloride monohydrate is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for regional anesthesia and neuropathic pain management in vivo .
|
-
- HY-147560
-
|
Sigma Receptor
Opioid Receptor
|
Neurological Disease
|
σ1 Receptor/μ Opioid receptor modulator 1 (Compound 44) is a potent σ1 receptor antagonist and μ opioid receptor agonist with Kis of 1.86 nM and 2.1 nM, respectively.σ1 Receptor/μ Opioid receptor modulator 1 exhibits potent analgesic activity. σ1 Receptor/μ Opioid receptor modulator 1 can be used for the research of neuropathic pain .
|
-
- HY-B0563R
-
|
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
Cancer
|
Ropivacaine (Standard) is the analytical standard of Ropivacaine. This product is intended for research and analytical applications. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is used for the research of neuropathic pain management .
|
-
- HY-107794
-
Disodium clodronate tetrahydrate
|
Others
|
Neurological Disease
Inflammation/Immunology
Cancer
|
Clodronate disodium tetrahydrate (Disodium clodronate tetrahydrate) is first-generation bisphosphonate, with anti-osteoporotic, anti-inflammatory and analgesic effects. Clodronate disodium tetrahydrate is a selective, potent, reversible and Cl - competitive vesicular nucleotide transporter (VNUT) inhibitor, with an IC50 of 15.6 nM. Clodronate disodium tetrahydrate inhibits vesicular ATP release from neurons and reduces chronic neuropathic and inflammatory pain .
|
-
- HY-18099A
-
E-52862 hydrochloride
|
Sigma Receptor
5-HT Receptor
|
Neurological Disease
|
S1RA (E-52862) hydrochloride is an orally active and selective sigma-1 receptor (σ1R) antagonist with a Ki value of 17 nM. S1RA hydrochloride shows good selectivity against σ2R (Ki >1000 nM). S1RA hydrochloride is a human 5-HT2B receptor antagonist with an IC50 value of 4.7 μM. S1RA hydrochloride inhibits neuropathic pain and activity-induced spinal sensitization .
|
-
- HY-155707
-
|
Dopamine Receptor
|
Inflammation/Immunology
|
MOR agonist-3 (Compound 84) is a D3R/MOR antagonist/partial agonist a(Ki 382 nM and 55.2 nM respectively). MOR agonist-3 has the potential to produce analgesic effects through MOR (μ-opioid receptor) (HY-149337) partial agonists and to reduce opioid abuse through D3R antagonists. MOR agonist-3 can be used in the treatment of inflammation and neuropathic pain research .
|
-
- HY-B0563BS
-
|
Isotope-Labeled Compounds
Potassium Channel
Sodium Channel
|
Neurological Disease
|
Ropivacaine-d7 hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B) . Ropivacaine hydrochloride is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for neuropathic pain management in vivo .
|
-
- HY-A0093
-
KOE-1173 hydrochloride
|
Sodium Channel
|
Cardiovascular Disease
Neurological Disease
|
Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research .
|
-
- HY-15568A
-
|
P2X Receptor
|
Neurological Disease
Inflammation/Immunology
|
A-317491 sodium salt hydrate is a potent, selective and non-nucleotide antagonist of P2X3 and P2X2/3 receptors, with Kis of 22, 22, 9, and 92 nM for hP2X3, rP2X3, hP2X2/3, and rP2X2/3, respectively. A-317491 sodium salt hydrate is highly selective (IC50>10 μM) over other P2 receptors and other neurotransmitter receptors, ion channels, and enzymes. A-317491 sodium salt hydrate reduces inflammatory and neuropathic pain by blocking P2X3 and P2X2/3 receptor-mediated calcium flux .
|
-
- HY-15568
-
|
P2X Receptor
|
Neurological Disease
Inflammation/Immunology
|
A-317491 is a potent, selective and non-nucleotide antagonist of P2X3 and P2X2/3 receptors, with Kis of 22, 22, 9, and 92 nM for hP2X3, rP2X3, hP2X2/3, and rP2X2/3, respectively. A-317491 is highly selective (IC50>10 μM) over other P2 receptors and other neurotransmitter receptors, ion channels, and enzymes. A-317491 reduces inflammatory and neuropathic pain by blocking P2X3 and P2X2/3 receptor-mediated calcium flux .
|
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-115681R
-
|
Calcium Channel
|
Neurological Disease
|
(2R/S)-6-PNG (Standard) is the analytical standard of (2R/S)-6-PNG. This product is intended for research and analytical applications. (2R/S)-6-PNG (6-Prenylnaringenin) is a potent and reversible Cav3.2 T-type Ca2+ channels (T-channels) blocker. (2R/S)-6-PNG can penetrate the blood-brain barrier (BBB). (2R/S)-6-PNG suppresses neuropathic and visceral pain in mice .
|
-
- HY-148708
-
|
iGluR
|
Neurological Disease
|
Oleoyl-D-lysine is a selective Glycine Transporter-2 (GlyT2) inhibitor based on lipid. Oleoyl-D-lysine reverses neuropathic pain in mice, shows antidrowsiness effect on chronic neuropathic pain. Oleoyl-D-lysine is safe and effective without respiratory depression .
|
-
- HY-107794R
-
|
Others
|
Neurological Disease
Inflammation/Immunology
Cancer
|
Clodronate (disodium tetrahydrate) (Standard) is the analytical standard of Clodronate (disodium tetrahydrate). This product is intended for research and analytical applications. Clodronate disodium tetrahydrate (Disodium clodronate tetrahydrate) is first-generation bisphosphonate, with anti-osteoporotic, anti-inflammatory and analgesic effects. Clodronate disodium tetrahydrate is a selective, potent, reversible and Cl-competitive vesicular nucleotide transporter (VNUT) inhibitor, with an IC50 of 15.6 nM. Clodronate disodium tetrahydrate inhibits vesicular ATP release from neurons and reduces chronic neuropathic and inflammatory pain .
|
-
- HY-A0093R
-
KOE-1173 (hydrochloride) (Standard)
|
Sodium Channel
|
Cardiovascular Disease
Neurological Disease
|
Mexiletine (hydrochloride) (Standard) is the analytical standard of Mexiletine (hydrochloride). This product is intended for research and analytical applications. Mexiletine is an orally effective antiarrhythmic agent which has also been found to be effective for myotonia and neuropathic pain. Mexiletine exerts its efficacy through blocking sodium channels (IC50 : 75±8 μM for tonic block, 23.6±2.8 μM for use-dependent block), therefore can be used for cardiovascular and neurological research .
|
-
- HY-18099
-
S1RA
2 Publications Verification
E-52862
|
Sigma Receptor
5-HT Receptor
|
Neurological Disease
|
S1RA (E-52862) is a highly selective σ1 receptor (σ1R) antagonist with Kis of 17 nM and 23.5 nM for human σ1R and guinea pig σ1R, respectively. S1RA has Moderate antagonistic activity for human 5-HT2B receptor (Ki= 328 nM). S1RA has antinociceptive effects in neuropathic pain models. S1RA prevents mechanical and cold hypersensitivity in Oxaliplatin (HY-17371)-treated mice .
|
-
- HY-P1626
-
|
Opioid Receptor
|
Neurological Disease
|
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .
|
-
- HY-171244
-
-
- HY-103218
-
|
Adrenergic Receptor
|
Neurological Disease
|
Talsupram (hydrochloride) is a selective norepinephrine inhibitor with high affinity for norepinephrine transporter (NET) and can be used in the study of neuropathic pain .
|
-
- HY-B1583
-
Zucapsaicin; Civamide; cis-Capsaicin
|
TRP Channel
HSV
|
Neurological Disease
|
(Z)-Capsaicin is the cis isomer of capsaicin, acts as an orally active TRPV1 agonist, and is used in the research of neuropathic pain.
|
-
- HY-156596A
-
|
Sodium Channel
|
Neurological Disease
|
Aneratrigine (hydrochloride) is a sodium channel protein type 9 subunit alpha blocker. Aneratrigine (hydrochloride) can be used for neuropathic pain diseases research .
|
-
- HY-156596
-
|
Sodium Channel
|
Neurological Disease
|
Aneratrigine is a sodium channel protein type 9 subunit alpha blocker. Aneratrigine can be used for neuropathic pain diseases research .
|
-
- HY-101290A
-
|
Cyclin G-associated Kinase (GAK)
AAK1
|
Neurological Disease
|
BMT-090605 hydrochloride is a potent, selective the adapter protein-2 associated kinase 1 (AAK1) inhibitor with an IC50 value of 0.6 nM. BMT-090605 hydrochloride shows antinociceptive activity. BMT-090605 hydrochloride inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50 values of 45 nM and 60 nM, respectively. BMT-090605 hydrochloride can be used for the research of neuropathic pain .
|
-
- HY-101290
-
|
AAK1
Cyclin G-associated Kinase (GAK)
|
Neurological Disease
|
BMT-090605 is a potent, selective the adapter protein-2 associated kinase 1 (AAK1) inhibitor with an IC50 value of 0.6 nM. BMT-090605 shows antinociceptive activity. BMT-090605 inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50 values of 45 nM and 60 nM, respectively. BMT-090605 can be used for the research of neuropathic pain .
|
-
- HY-112430
-
|
TRP Channel
|
Neurological Disease
|
TRPM8 antagonist 2 is a potent and selective TRPM8 antagonist, with an IC50 of 0.2 nM, used in the research of neuropathic pain syndromes.
|
-
- HY-117922
-
-
- HY-170687
-
-
- HY-168139
-
|
P2Y Receptor
|
Cancer
|
MRS4865 (compund 7a) is a chimera of a P2Y14 receptor antagonist and a UDP-glucose agonist that protects against neuropathic pain .
|
-
- HY-167852
-
-
- HY-N3710
-
Kumujian G; O-Methylpicrasidine I
|
JAK
Apoptosis
|
Neurological Disease
Cancer
|
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain .
|
-
- HY-122231
-
|
Adenosine Receptor
|
Neurological Disease
|
MRS3558 is a potent and selective A3AR agonist, with Ki values of 0.6 nM for humans and 0.9 nM for rats, making it suitable for research in the fields of neuropathic pain and anesthesia .
|
-
- HY-149863
-
|
Epigenetic Reader Domain
|
Neurological Disease
|
DDO-8926 is a potent and selective BET inhibitor that can significantly reduce mechanical hypersensitivity by inhibiting the expression of pro-inflammatory cytokines and reducing excitability for neuropathic pain research .
|
-
- HY-14909
-
Bardoxolone
Maximum Cited Publications
17 Publications Verification
CDDO; RTA 401
|
Keap1-Nrf2
Necroptosis
|
Metabolic Disease
Cancer
|
Bardoxolone (RTA 401; CDDO) is a novel nuclear regulatory factor (NRf-2) activator. Bardoxolone is a potent necroptosis inhibitor that inhibits Z-VAD-FMK-induced necroptosis. Bardoxolone methyl enhances the antioxidant system, modulates inflammatory cytokines and inhibits apoptosis in rat kidney, demonstrating inhibition on APAP-induced acute kidney injury (AKI) and analgesic effect. Additionally, Bardoxolone methyl decreases Paclitaxel (PAC) (HY-B0015)-induced mitochondrial damage in neuronal cells. Bardoxolone methyl is promising for the research of chemotherapy-induced neuropathic pain and chronic kidney disease .
|
-
- HY-135653
-
EC5026
1 Publications Verification
BPN-19186
|
Epoxide Hydrolase
|
Neurological Disease
|
EC5026 (BPN-19186) is a first-in-class, non-opioid and orally active soluble Epoxide Hydrolase (sEH) inhibitor. EC5026 shows efficacy for inflammatory and neuropathic pain .
|
-
- HY-14777
-
RGH-896
|
iGluR
|
Neurological Disease
|
Radiprodil (RGH-896) is an orally active and selective NMDA NR2B antagonist. A potential therapeutic agent in treatment of neuropathic pain and possibly other chronic pain conditions .
|
-
- HY-A0057S
-
|
Calcium Channel
|
Neurological Disease
|
Gabapentin-d4 is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.
|
-
- HY-106856
-
NT-11624
|
iGluR
|
Cancer
|
Dimiracetam is an orally active compound, with anti-neuropathic activity. Dimiracetam inhibits hypersensitivity and neurological alterations, and inhibits Sorafenib (HY-10201)-induced neuropathy in cold stimulation rat models .
|
-
- HY-100933
-
-
- HY-147306A
-
|
NO Synthase
|
Neurological Disease
|
(S)-ZLc002 is a S-enantiomer of ZLc-002. ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain .
|
-
- HY-B1583R
-
|
TRP Channel
HSV
|
Neurological Disease
|
(Z)-Capsaicin (Standard) is the analytical standard of (Z)-Capsaicin. This product is intended for research and analytical applications. (Z)-Capsaicin is the cis isomer of capsaicin, acts as an orally active TRPV1 agonist, and is used in the research of neuropathic pain.
|
-
- HY-B0444A
-
|
Autophagy
Apoptosis
ERK
|
Neurological Disease
Cancer
|
Maprotiline is a highly selective noradrenergic reuptake inhibitor that has strong antidepressant, antitumor and neuropathic pain-relieving effects. Maprotiline induces cancer cell apoptosis by targeting the ERK signaling pathway and CRABP1 .
|
-
- HY-100326
-
-
- HY-B0161ES
-
(Rac)-Duloxetine-d3 hydrochloride
|
Isotope-Labeled Compounds
Serotonin Transporter
|
Neurological Disease
|
(±)-Duloxetine-d3 (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research[1].
|
-
- HY-B0444
-
|
Autophagy
Apoptosis
ERK
|
Neurological Disease
Cancer
|
Maprotiline hydrochloride is a highly selective noradrenergic reuptake inhibitor that has strong antidepressant, antitumor and neuropathic pain-relieving effects with oral activity. Maprotiline hydrochloride induces cancer cell apoptosis by targeting the ERK signaling pathway and CRABP1 .
|
-
- HY-N0630R
-
|
GCGR
|
Neurological Disease
|
Shanzhiside methyl ester (Standard) is the analytical standard of Shanzhiside methyl ester. This product is intended for research and analytical applications. Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance .
|
-
- HY-N0630
-
|
GCGR
|
Neurological Disease
|
Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance .
|
-
- HY-101418
-
|
P2X Receptor
|
Neurological Disease
|
JNJ-47965567 is a centrally permeable, high-affinity, selective P2X7 antagonist, with pKis of 7.9 and 8.7 for human and rat P2X7, respectively. JNJ-47965567 can be used to probe the role of central P2X7 in rodent models of CNS pathophysiology .
|
-
- HY-167696
-
|
11β-HSD
|
Neurological Disease
|
11β-HSD1-IN-16 is an inhibitor of the 11β-hydroxysteroid dehydrogenase HSD11B1, demonstrating an IC of 0.34 μM, making it a valuable tool for research on neuropathic pain, inflammatory pain, and occipital neuralgia.
|
-
- HY-131868
-
|
TRP Channel
|
Neurological Disease
|
TRPV3 antagonist 74a is a potent and selective TRPV3 antagonist. TRPV3 antagonist 74a displays no significant activity against a panel of other ion channels. TRPV3 antagonist 74a can be used for the research of neuropathic pain .
|
-
- HY-170962
-
|
Neprilysin
Aminopeptidase
|
Neurological Disease
|
SDUY817 is a dual APN/NEP inhibitor, with IC50 values of 0.29 μM for APN and 7.4 μM for NEP. SDUY817 exerts analgesic effects in a concentration- and time-dependent manner, and can be used for research in the field of neuropathic pain disorders .
|
-
- HY-B0444R
-
|
Autophagy
Apoptosis
ERK
|
Neurological Disease
Cancer
|
Maprotiline (hydrochloride) (Standard) is the analytical standard of Maprotiline (hydrochloride). Maprotiline (hydrochloride) (Standard) is a highly selective noradrenergic reuptake inhibitor that has strong antidepressant, antitumor and neuropathic pain-relieving effects. Maprotiline (hydrochloride) (Standard) induces cancer cell apoptosis by targeting the ERK signaling pathway and CRABP1 .
|
-
- HY-118974
-
|
Calcium Channel
|
Neurological Disease
Cancer
|
PD-151307 is an N-type calcium channel antagonist with significant inhibitory effects in IMR-32 human neuroblastoma cells, exhibiting an IC50 of 0.32 µM. PD-151307 can be used in research related to cancer therapy, anticonvulsants, and neuropathic pain .
|
-
- HY-105283
-
|
Sodium Channel
|
Others
Neurological Disease
|
PF 04531083 is an orally active and selective NaV1.8 blocker with an IC50 of 0.7 μM. PF 04531083 is a blood-brain barrier (BBB) penetrant compound. PF 04531083 can be used for the research of respiratory system and neuropathic/inflammatory pain .
|
-
- HY-124996
-
|
NO Synthase
|
Neurological Disease
Inflammation/Immunology
Cancer
|
(Rac)-ZLc-002, an inhibitor of nNOS interaction with nitric oxide synthase 1 adaptor protein (NOS1AP), suppresses inflammatory nociception and chemotherapy-induced neuropathic pain and synergizes with Paclitaxel (HY-B0015) to reduce tumor cell viability .
|
-
- HY-160663
-
-
- HY-110036A
-
L768242 hydrochloride
|
Cannabinoid Receptor
|
Neurological Disease
|
GW-405833 (L768242) hydrochloride is a potent, selective cannabinoid receptor 2 (CB2) agonist with an EC50 of 50.7 nM. GW-405833 hydrochloride also behaves as a noncompetitive CB1 antagonist. GW-405833 hydrochloride suppresses inflammatory and neuropathic pain .
|
-
- HY-118030
-
|
Calcium Channel
|
Neurological Disease
|
RQ-00311651 is a T-type calcium channel blocker that specifically targets the Cav3.2 isoform with a role in neuropathic and visceral pain. RQ-00311651 significantly inhibits T currents in HEK293 cells expressing human Cav3.1 or Cav3.2. RQ-00311651 also inhibited high potassium-induced calcium signaling. RQ-00311651 also inhibits antiallergic properties in rats and mice with neuropathic pain induced by spinal nerve injury or Paclitaxel (HY-B0015). Oral and intraperitoneal injection (10-20 mg/kg) inhibits Cerulein (HY-A0190)-induced acute pancreatitis and cyclophosphamide-induced cystitis in mice .
|
-
- HY-124283A
-
|
Cannabinoid Receptor
|
Neurological Disease
|
LEI-101 is a potent, selective, and orally bioavailable cannabinoid CB2 receptor agonist, with a pEC50 of 8 for hCB2, and a pKi of less than 4 for hERG. LEI-101 is ~100-fold more potent in binding to CB2 receptors than to CB1 receptors .
|
-
- HY-113689
-
|
Cannabinoid Receptor
|
Neurological Disease
|
GAT211 is a cannabinoid 1 receptor (CB1R) positive allosteric modulator (PAM). GAT211 activates cAMP and β-arrestin2 with EC50 values of 260 nM and 650 nM, respectively. GAT211 inhibits GAT211 can be used for neuropathic and/or inflammatory pain research .
|
-
- HY-W097625
-
-
- HY-P3223
-
|
Opioid Receptor
|
Neurological Disease
|
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .
|
-
- HY-117731
-
|
Sigma Receptor
|
Neurological Disease
|
UKH-1114 is a potent σ2 receptor/Tmem97 agonist with a Ki value of 46 nM, showing antimechanical hypersensitivity effects. UKH-1114 alleviates mechanical hypersensitivity caused by nerve injury without any movement disorders in mice. UKH-1114 is promising for research of neuropathic pain .
|
-
- HY-A0057AS2
-
|
Isotope-Labeled Compounds
Calcium Channel
|
Neurological Disease
Cancer
|
Gabapentin-d4 hydrochloride is the deuterium labeled Gabapentin hydrochloride (HY-A0057A). Gabapentin hydrochloride is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .
|
-
- HY-110099
-
|
CXCR
|
Inflammation/Immunology
|
(±)-NBI-74330 is a potent and selective CXCR3 antagonist. (±)-NBI-74330 not only reduces tactile and thermal hypersensitivity but also enhances the analgesic properties of morphine. (±)-NBI-74330 can reduce microglial cell activation, increase astroglial cell activation, and downregulate the expression of some CXCR3 ligands in a rat neuropathic pain model .
|
-
- HY-N2573
-
L-Corydalmine; TLZ-16
|
Fungal
CXCR
|
Infection
Neurological Disease
|
Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi . Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity . Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway .
|
-
- HY-149766
-
|
HDAC
|
Neurological Disease
|
PB94 is a selective HDAC11 inhibitor (IC50=108 nM). PB94 can be radiolabeled as [11C]-PB94 for use in positron emission tomography (PET), as well as brain uptake and metabolic properties in administered live animals. PB94 improves neuropathic pain in mice and could be used to study neurological indications .
|
-
- HY-W028263
-
-
- HY-N0478
-
Neoline
1 Publications Verification
Bullatine B
|
Others
|
Neurological Disease
|
Neoline (Bullatine B)) is the active ingredient of the active ingredient (PA), which can be used to cure the disease. Neoline Flow Suppression Nav1.7 Electrical Flow Control (VGSC),Improve diabetes mechanical pain sensitivity. Neoline has a list of compounds that can be used, research on its use, and the quality of its processing during processing in pain.
|
-
- HY-120092
-
|
AAK1
|
Neurological Disease
|
BMT-046091 is a selective inhibitor of adaptor-associated kinase 1 (AAK1). BMT-046091 inhibits phosphorylation of the μ2 peptide by AAK1 with an IC50 value of 2.8 nM .
|
-
- HY-163763
-
|
G2A (GPR132)
|
Neurological Disease
|
T-10418 is an agonist for G2 accumulation protein (G2A) (also known as G protein-coupled receptor GPR132) with an EC50 of 0.82 μM. T-10418 exhibits a sensitizing effect on mouse primary sensory neurons. T-10418 exhibits good pharmacokinetic characteristics, and no obvious toxicity (at 100 μM) in mouse models .
|
-
- HY-167855
-
|
P2Y Receptor
|
Inflammation/Immunology
|
MRS4833 (compound 15) is an orally active, potent, competitive P2Y14R antagonist with an of IC50 of 5.92 nM for hP2Y14R and an IC50 of 4.8 nM for mP2Y14R. MRS4833 reduces airway eosinophilia in a protease-mediated asthma model and reverses chronic neuropathic pain in a mouse CCI model .
|
-
- HY-115597
-
|
Calcium Channel
|
Neurological Disease
|
BTT-266 is an antagonist forcalcium channel, through suppression of the CaVα1-AID-CaVβ3 interaction, with a Ki of 1.4 μM. BTT-266 modulates the activation of voltage-dependent CaV2.2. BTT-266 exhibits analgesic efficacy against neuropathic pain in rats model .
|
-
- HY-N6967
-
(-)-α-Bisabolol
|
Apoptosis
|
Neurological Disease
Inflammation/Immunology
|
Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .
|
-
- HY-135228
-
|
Calcium Channel
|
Neurological Disease
|
GZ4 is a calcium current inhibitor with direct inhibitory activity on cell surface channels. GZ4 inhibition reverses mechanical hyperalgesia/hyperalgesia in a spinal nerve ligation-induced neuropathic pain model. The mechanism of action of GZ4 is similar to that of gabapentin, but the time course of its biological effects is more rapid, indicating that GZ4 can directly inhibit calcium channel currents .
|
-
- HY-B1661
-
Hexone chloride
|
Biochemical Assay Reagents
|
Cardiovascular Disease
Others
|
Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.
|
-
- HY-13954
-
|
P2X Receptor
|
Neurological Disease
Inflammation/Immunology
|
A 839977 is a P2X7 selective antagonist; it blocks BzATP-evoked calcium influx at recombinant human, rat and mouse P2X7 receptors (IC50 values are 20 nM, 42 nM and 150 nM respectively) and reduces inflammatory and neuropathic pain in animal models; the antihyperalgesic effects of P2X7 receptor blockade are mediated by blocking the release of IL-1beta .
|
-
- HY-170961
-
|
Aminopeptidase
Neprilysin
|
Neurological Disease
|
SDUY816 is an oral active dual APN/NEP inhibitor, with IC50 values of 0.68 μM for APN and 6.9 μM for NEP. SDUY816 exhibits analgesic effects and demonstrates good safety and pharmacokinetic profiles, with an oral bioavailability of 27% and a half-life of 4.02 hours in rats (oral administration, 10 mg/kg). SDUY816 has potential applications in the research of neuropathic pain disorders .
|
-
- HY-N0405
-
|
TNF Receptor
Interleukin Related
|
Neurological Disease
Cancer
|
Orientin is a neuroprotective agentinhibits which has anti-inflammation, anti-oxidative, anti-tumor, and cardio protection properties. Orientin inhibits the levels of IL-6, IL-1β and TNF-α. Orientin increases IL-10 level. Orientin exhibits neuroprotective effect by inhibits TLR4 and NF-kappa B signaling pathway. Orientin can used in study neuropathic pain .
|
-
- HY-125821
-
|
Sigma Receptor
|
Neurological Disease
|
Sigma‑1 receptor antagonist 1 (compound 137) is a potent and selective sigma-1 receptor (σ1R) antagonist, with a high binding affinity to σ1R receptor (Ki = 1.06 nM). Sigma‑1 receptor antagonist 1 exhibits antineuropathic pain activity and acts as a promising agent for the treatment of neuropathic pain .
|
-
- HY-120380
-
|
Autophagy
|
Inflammation/Immunology
|
FeTMPyP is an orally active peroxynitrite (ONOO ?) scavenger. FeTMPyP reduces nitrative stress and increases autophagy. FeTMPyP reduces PARP over-activation and neuroinflammation in chronic constriction injury (CCI)-induced rats, and ameliorates functional, behavioral and biochemical deficits .
|
-
- HY-114954
-
-
- HY-135891
-
|
CCR
|
Neurological Disease
|
AZD2423 is a potent, selective, orally bioavailable, and non-competitive CCR2 chemokine receptor negative allosteric modulator. AZD2423 has an IC50 of 1.2 nM for CCR2 Ca 2+ flux .
|
-
- HY-B0563S1
-
|
Isotope-Labeled Compounds
Sodium Channel
Potassium Channel
|
Cardiovascular Disease
Neurological Disease
|
Ropivacaine-d7 is deuterium labeled Ropivacaine. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese[1][2]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane[3]. Ropivacaine is used for the research of neuropathic pain management[1].
|
-
- HY-115510
-
SPRi3
|
Others
|
Inflammation/Immunology
|
SPR inhibitor 3 (SPRi3) is a potent sepiapterin reductase (SPR) inhibitor. SPR inhibitor 3 (SPRi3) displays high binding affinity to human SPR in a cell-free assay (IC50=74 nM) and efficiently reduces biopterin levels in a cell-based assay (IC50=5.2 μM). SPR inhibitor 3 (SPRi3) reduces neuropathic and inflammatory pain through a reduction of BH4 levels .
|
-
- HY-125820
-
|
Sigma Receptor
Potassium Channel
|
Neurological Disease
|
Sigma-1 receptor antagonist 3 (compound135) is a potent and selective Sigma-1 (σ1) receptor antagonist with a Ki of 1.14 nM. Sigma-1 receptor antagonist 3 inhibits Human Ether-a-go-go-Related Gene (hERG) with an IC50 of 1.54 μM. Sigma-1 receptor antagonist 3 has the potential for the neuropathic pain .
|
-
- HY-17444
-
|
PPAR
|
Metabolic Disease
Cancer
|
Tesaglitazar is a dual-target PPARα/γ agonist with an EC50 of 13.4 μM for rat PPARα and 3.6 μM for human PPARα. Tesaglitazar affects lipid and glucose metabolism by activating PPARα and PPARγ receptors, and has the potential to improve blood sugar and relieve pain. Tesaglitazar can be used to induce in vivo tumor models and can be used in the study of type 2 diabetes, dyslipidemia, and neuropathic pain .
|
-
- HY-N6967R
-
|
Apoptosis
|
Neurological Disease
Inflammation/Immunology
|
Levomenol (Standard) is the analytical standard of Levomenol. This product is intended for research and analytical applications. Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .
|
-
- HY-16935S
-
JNJ-39439335-d6
|
Isotope-Labeled Compounds
TRP Channel
|
Neurological Disease
|
Mavatrep-d6 (JNJ-39439335-d6) is a deuterated labeled Mavatrep (HY-16935). Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca 2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain .
|
-
- HY-108656
-
|
P2Y Receptor
Arrestin
|
Cardiovascular Disease
|
MRS2365 is a potent and selective P2Y1 receptor (EC50=0.4 nM) /[ 35S]GTPγS binding/β-arrestin 2 recruitment agonist with an EC50 of 0.4 nM. MRS2365 relieves mechanical allodynia and increases mechanical sensitivity. MRS2365 shows little agonist or antagonist activity at the P2Y12 or P2Y13 receptors .
|
-
- HY-108656A
-
|
P2Y Receptor
Arrestin
|
Cardiovascular Disease
|
MRS2365 trisodium is a potent and selective P2Y1 receptor (EC50=0.4 nM)/[ 35S]GTPγS binding/β-arrestin 2 recruitment agonist. MRS2365 trisodium relieves mechanical allodynia and increases mechanical sensitivity .
|
-
- HY-136363
-
|
TRP Channel
|
Neurological Disease
|
MDR-652 is a highly specific and efficacious transient receptor potential vanilloid 1 (TRPV1) ligand with agonist activity. The Kis are 11.4 and 23.8 nM for hTRPV1 and rTRPV1, respectively. The EC50s are 5.05 and 93 nM for hTRPV1 and rTRPV1, respectively. Potent topical analgesic activity .
|
-
- HY-155706
-
|
Opioid Receptor
Dopamine Receptor
|
Inflammation/Immunology
|
MOR agonist-2 (compound 46) is a antagonist of D3R and agonist of MOR (Ki: 7.26 nM and 564 nM, respectively). MOR agonist-2 has the potential to produce analgesic effects through MOR partial agonism. MOR agonist-2 reduces opioid-misuse liability via D3R antagonism .
|
-
- HY-13106
-
EMA401; PD-126055; (S)-EMA400
|
Angiotensin Receptor
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
Olodanrigan (EMA401) is a highly selective, orally active, peripherally restricted angiotensin II type 2 receptor (AT2R) antagonist. It is under development as a neuropathic pain therapeutic agent. Olodanrigan (EMA401) analgesic action appears to involve inhibition of augmented AngII/AT2R induced p38 and p42/p44 MAPK activation, and hence inhibition of DRG neuron hyperexcitability and sprouting of DRG neurons .
|
-
- HY-N2071
-
-
- HY-13106A
-
EMA401 sodium; PD-126055 sodium
|
Angiotensin Receptor
|
Neurological Disease
Endocrinology
|
Olodanrigan (EMA401) sodium is a highly selective, orally active, peripherally restricted angiotensin II type 2 receptor (AT2R) antagonist. Olodanrigan sodium is under development as a neuropathic pain therapeutic agent. Olodanrigan sodium analgesic action appears to involve inhibition of augmented AngII/AT2R induced p38 and p42/p44 MAPK activation, and hence inhibition of DRG neuron hyperexcitability and sprouting of DRG neurons .
|
-
- HY-N0405R
-
|
TNF Receptor
Interleukin Related
|
Neurological Disease
Cancer
|
Orientin (Standard) is the analytical standard of Orientin. This product is intended for research and analytical applications. Orientin is a neuroprotective agentinhibits which has anti-inflammation, anti-oxidative, anti-tumor, and cardio protection properties. Orientin inhibits the levels of IL-6, IL-1β and TNF-α. Orientin increases IL-10 level. Orientin exhibits neuroprotective effect by inhibits TLR4 and NF-kappa B signaling pathway. Orientin can used in study neuropathic pain .
|
-
- HY-146383
-
|
Histamine Receptor
Cholinesterase (ChE)
Monoamine Oxidase
|
Neurological Disease
|
H3R antagonist 2 (Compound 23) is a multitarget histamine H3 receptor (H3R) antagonist with a Ki of 170 nM for hH3R . H3R antagonist 2 shows inhibitory effects with IC50 values of 180, 880 and 775 nM for acetylcholinesterase, butyrylcholinesterase and human monoamine oxidase B (hMAO B), respectively. H3R antagonist 2 shows favorable anti-neuropathic pain and memory-enhancing effects. H3R can across BBB .
|
-
- HY-117626
-
|
AAK1
Cyclin G-associated Kinase (GAK)
SARS-CoV
|
Infection
Neurological Disease
Inflammation/Immunology
|
LP-935509 is an orally active, potent, selective, ATP-competitive and brain-penetrant inhibitor of adaptor protein-2 associated kinase 1 (AAK1) with an IC50 of 3.3 nM and a Ki of 0.9 nM, respectively. LP-935509 is also a potent inhibitor of BIKE (IC50=14 nM) and a modest inhibitor of GAK (IC50=320 nM). LP-935509 shows antinociceptive activity. LP-935509 can be used for neuropathic pain and SARS-CoV-2 research .
|
-
- HY-N2071R
-
|
Cytochrome P450
Fungal
Apoptosis
Caspase
|
Infection
Neurological Disease
Inflammation/Immunology
Cancer
|
Cedrol (Standard) is the analytical standard of Cedrol. This product is intended for research and analytical applications. Cedrol is a potent competitive inhibitor of cytochrome P-450(CYP) enzyme. Cedrol plays an anticancer role by inducing cell cycle arrest and Caspase-dependent apoptosis. Cedrol acts as a neutrophil agonist that can desensitize cells to subsequent stimulation of N-formyl peptides. Cedrol prevents neuropathic pain caused by chronic contractile injury by inhibiting oxidative stress and inflammation. In addition, Cedrol has antibacterial, hair loss prevention and anti-anxiety properties.
|
-
- HY-167862
-
|
Endogenous Metabolite
|
Neurological Disease
|
UCM-05194 is a selective LPA1 receptor agonist with activity to improve neuropathic pain. UCM-05194 is a LPA1 agonist that exhibits potent and selective properties in its pharmacologically similar properties. UCM-05194 triggers LPA1-mediated cellular effects and leads to internalization of the receptor, resulting in functional inactivation in primary sensory neurons. UCM-05194 effectively reduces pain perception in in vivo models. UCM-05194 can be used to conduct research on progressive systemic diseases .
|
-
- HY-106199
-
|
Adenosine Receptor
|
Neurological Disease
Inflammation/Immunology
|
Adenosine A1 receptor activator T62 is an allosteric enhancer of adenosine A1 receptor. Adenosine A1 receptor activator T62 produces antinociception in animal models of acute pain and also reduces hypersensitivity in models of inflammatory and nerve-injury pain .
|
-
- HY-135871A
-
|
AAK1
|
Neurological Disease
|
BMT-124110 formic is a potent, selective AAK1 inhibitor, with an IC50 of 0.9 nM. BMT-124110 shows antinociceptive activity. BMT-124110 formic inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50s of 17 and 99 nM, respectively .
|
-
- HY-161712
-
|
NAMPT
|
Cancer
|
Nampt-IN-12 (compound 9) is a derivative of N-Pyridinylthiophene carboxamide, exhibiting activity against peripheral nerve sheath tumor cells. Nampt-IN-12 is metabolized via the enzymes NAMPT and NMNAT1, both integral to the NAD salvage pathway, into an adenosine diphosphate (AD) derivative, which is an analog of NAD and capable of inhibiting inosine monophosphate dehydrogenase (IMPDH), leading to the accumulation of inosine monophosphate (IMP) within cells. With its favorable ability to cross the blood-brain barrier, Nampt-IN-12 holds potential for research in cancers affecting both the central and peripheral nervous systems .
|
-
- HY-135871
-
|
AAK1
|
Neurological Disease
|
BMT-124110 is a potent, selective AAK1 inhibitor with an IC50 of 0.9 nM. BMT-124110 shows antinociceptive activity. BMT-090605 inhibits BMP-2-inducible protein kinase (BIKE) and Cyclin G-associated kinase (GAK) with IC50s of 17 and 99 nM, respectively .
|
-
- HY-155318A
-
|
Orphan Receptor
|
Endocrinology
|
GPR3 agonist-2(compound 32) is a potent full agonist of G protein-coupled receptor 3, with the IC50of 260 nM .
|
-
- HY-168214
-
|
Potassium Channel
|
Neurological Disease
|
Kv7.2/Kv7.3 agonist 1 (Compound 16) is an orally active agonist for KV7.2/7.3 channel (KCNQ2/3) with an EC50 of 1.03 μM. Kv7.2/Kv7.3 agonist 1 exhibits analgesic efficacy in mice chronic constriction injury (CCI) model and mice Streptozotocin (HY-13753)-induced diabetic peripheral neuropathic pain (DPNP) model, with ED50 of 12.02 and 9.63 mg/kg .
|
-
- HY-Y0790
-
p-Isopropylbenzaldehyde
|
α-synuclein
|
Infection
Neurological Disease
Inflammation/Immunology
Cancer
|
Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC50= 0.00085 mg/mL), α-glucosidase (IC50=0.5 mg/mL) and lipoxygenase (IC50=1370 μM). Cuminaldehyde also inhibits the fibrillation of α-synuclein and prevents its aggregation. Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .
|
-
- HY-N0131
-
|
MMP
Endogenous Metabolite
|
Neurological Disease
Inflammation/Immunology
|
Stigmasterol is an orally acitve, immunomodulatory agent with anti-inflammatory and neuroprotective effect, as well as able to cross the blood-brain barrier. Stigmasterol activates AMPK, which in turn inhibits NF-κB and NLRP3 signaling pathways, reduces microglia-mediated neuroinflammation, and alleviates cognitive impairment and Alzheimer's disease. Stigmasterol regulates M1/M2 polarization of microglia through the TLR4/ NF-κB pathway, thereby reducing neuropathic pain. Stigmasterol can be used for neurodegenerative diseases, inflammatory diseases, and pain management, among others .
|
-
- HY-149335
-
|
Sigma Receptor
Histamine Receptor
|
Neurological Disease
|
Sigma-1 receptor antagonist 5 (compound 12),a 4-pyridylpiperidine derivative with analgesic activity,is an antagonist of sigma receptor (Ki=4.5 nM (σ1R),10 nM (σ2R)) and histamine H3 (hH3R,Ki=7.7 nM,IC50=215 nM). Sigma-1 receptor antagonist 5 suppresses Capsaicin-induced nociception with antinociceptive activity and shows potent efficacy in nociceptive and neuropathic pain models .
|
-
- HY-116005
-
|
Adenosine Kinase
|
Neurological Disease
Inflammation/Immunology
|
A-286501 is an orally active and potent carbocyclic nucleoside adenosine kinase inhibitor with an IC50 value of 0.47 nM, which shows analgesic and anti-inflammatory effects. A-286501 reduces nociception in animal models of acute (thermal), inflammatory (formalin and carrageenan) and neuropathic (L5/L6 nerve ligation and streptozotocin-induced diabetic) pain. A-286501 also reduces Carrageenan (HY-125474)-induced paw edema and myeloperoxidase activity in the injured paw. A-286501 is promising for research of analgesic and anti-inflammatory agents .
|
-
- HY-B1279A
-
Dipyrone
|
COX
Apoptosis
|
Inflammation/Immunology
Cancer
|
Metamizole sodium (Dipyrone) is an orally active cyclooxygenase (COX) inhibitor. Metamizole sodium can inhibit cell proliferation and promote cell apoptosis. Metamizole sodium has anti-inflammatory and antioxidant activities. Metamizole sodium is an antipyretic, analgesic and spasmolytic agent. .Metamizole sodium can be used in research to relieve a variety of pain .
|
-
- HY-143390
-
|
iGluR
|
Neurological Disease
|
NMDA receptor modulator 2 (Compound 1) is a potent NMDA receptor modulator. NMDA receptor modulator 2 can be used for neurological disorder research .
|
-
- HY-B0527A
-
|
Serotonin Transporter
5-HT Receptor
Histamine Receptor
mAChR
Adrenergic Receptor
Sodium Channel
Trk Receptor
|
Neurological Disease
Cancer
|
Amitriptyline hydrochloride is an inhibitor of serotonin reuptake transporter (SERT) and noradrenaline reuptake transporter (NET), with Kis of 3.45 nM and 13.3 nM for human SERT and NET, respectively. Amitriptyline hydrochloride also weakly binds to dopamine reuptake transporter (DAT) with a Ki of 2.58 μM. Amitriptyline hydrochloride also inhibits adrenergic, muscarinic, histamine and 5-HT receptors. Amitriptyline hydrochloride is a TrkA and TrkB receptors agonist with potent neurotrophic activity. Amitriptyline hydrochloride has antidepressant activity .
|
-
- HY-143396
-
|
iGluR
|
Neurological Disease
|
NMDA receptor modulator 5 (Compound 195) is a potent NMDA receptor modulator. NMDA receptor modulator 5 can be used for neurological disorder research .
|
-
- HY-B1279
-
Dipyrone hydrate
|
COX
Apoptosis
|
Inflammation/Immunology
|
Metamizole sodium hydrate (Dipyrone) is an orally active cyclooxygenase (COX) inhibitor.. Metamizole sodium hydrate can inhibit cell proliferation and promote cell apoptosis. Metamizole sodium hydrate has anti-inflammatory and antioxidant activities. Metamizole sodium hydrate is an antipyretic, analgesic and spasmolytic agent. Metamizole sodium hydrate can be used in research to relieve a variety of pain .
|
-
- HY-B1279R
-
|
COX
Apoptosis
|
Inflammation/Immunology
|
Metamizole (sodium hydrate) (Standard) is the analytical standard of Metamizole (sodium hydrate). This product is intended for research and analytical applications. Metamizole sodium hydrate (Dipyrone) is an orally active cyclooxygenase (COX) inhibitor.. Metamizole sodium hydrate can inhibit cell proliferation and promote cell apoptosis. Metamizole sodium hydrate has anti-inflammatory and antioxidant activities. Metamizole sodium hydrate is an antipyretic, analgesic and spasmolytic agent. Metamizole sodium hydrate can be used in research to relieve a variety of pain .
|
-
- HY-143393
-
|
iGluR
|
Neurological Disease
|
NMDA receptor modulator 4 (Compound 169) is a potent NMDA receptor modulator. NMDA receptor modulator 4 can be used for neurological disorder research .
|
-
- HY-143391
-
|
iGluR
|
Neurological Disease
|
NMDA receptor modulator 3 (Compound 99) is a potent NMDA receptor modulator. NMDA receptor modulator 3 can be used for neurological disorder research .
|
-
- HY-143397
-
|
iGluR
|
Neurological Disease
|
NMDA receptor modulator 6 (Compound 183) is a potent NMDA receptor modulator. NMDA receptor modulator 6 can be used for neurological disorder research .
|
-
- HY-B0527
-
-
- HY-B1279AR
-
|
COX
Apoptosis
|
Inflammation/Immunology
Cancer
|
Metamizole (sodium) (Standard) is the analytical standard of Metamizole (sodium). This product is intended for research and analytical applications. Metamizole sodium (Dipyrone) is an orally active cyclooxygenase (COX) inhibitor. Metamizole sodium can inhibit cell proliferation and promote cell apoptosis. Metamizole sodium has anti-inflammatory and antioxidant activities. Metamizole sodium is an antipyretic, analgesic and spasmolytic agent. .Metamizole sodium can be used in research to relieve a variety of pain [4] .
|
-
- HY-147638
-
|
Calcium Channel
|
Neurological Disease
|
MONIRO-1 is a T-type and N-type calcium channel blocker with IC50 values of 34, 3.3, 1.7 and 7.2 µM against hCav2.2, hCav3.1, hCav3.2 and hCav3.3, respectively .
|
-
- HY-14485
-
|
P2X Receptor
|
Neurological Disease
|
Ro-51 is a potent and selective dual P2X3/P2X2/3 antagonist, with IC50 of 2 nM and 5 nM for P2X3 and P2X2/3, respectively. Ro-51 can be used for the research for pain .
|
-
- HY-146281
-
-
- HY-161682
-
|
GPR84
|
Neurological Disease
|
GPR84 antagonist 9 (compound 320) is an orally active GPR84 antagonist with the IC50 of 0.012 μM. GPR84 antagonist 9 can be used for study of inflammatory-driven pain diseases .
|
-
- HY-148236
-
|
TRP Channel
|
Inflammation/Immunology
|
BAY-390 is a selective, across species active and brain penetrating TRPA1 inhibitor. BAY-390 inhibits hTRPA1 FLIPR, hTRPA1 Ephys, rTRPA1 FLIPR and rDRG Ephys with IC50s of 16, 82, 63 and 35 nM, respectively. BAY-390 can be used for the research of inflammation .
|
-
- HY-19960
-
BCTC
4 Publications Verification
|
TRP Channel
Insulin Receptor
CGRP Receptor
|
Neurological Disease
Metabolic Disease
Cancer
|
BCTC is an orally active current inhibitor of vanilloid receptor type 1 (VR1). BCTC is a transient receptor potential cation channel subfamily M member 8 (TRPM8) and transient receptor potential vanilloid 1 (TRPV1) antagonist. BCTC is an insulin sensitizer and secretor. BCTC has anticancer and analgesic effects .
|
-
- HY-17387
-
Huperzine A
|
Cholinesterase (ChE)
Apoptosis
iGluR
|
Neurological Disease
|
(-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC50 of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .
|
-
- HY-128971
-
|
Cathepsin
Parasite
|
Infection
Neurological Disease
|
LHVS is a potent, non-selective, irreversible, cell-permeable cysteine protease and cathepsin inhibitor. LHVS decreases actin ring formation. LHVS inhibits T. gondii invasion with an IC50 of 10 μM .
|
-
- HY-17387S1
-
Huperzine A-d4
|
iGluR
Cholinesterase (ChE)
Apoptosis
Isotope-Labeled Compounds
|
Neurological Disease
|
(-)-Huperzine A-d4 hydrochloride is deuterated labeled (-)-Huperzine A (HY-17387). (-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC50 of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .
|
-
- HY-147352
-
|
iGluR
|
Neurological Disease
|
NMDA receptor potentiator-1 (Compound 1368) is a subunit selective NMDA receptor potentiator with IC50s of 4 μM and 5 μM against NR2C and NR2D expression, respectively .
|
-
- HY-146282
-
|
GABA Receptor
|
Neurological Disease
|
mGAT-IN-1 (compound 28) is a potent and non-selective GAT inhibitor. mGAT-IN-1 has a high inhibitory potency toward mGAT3, with an IC50 of 2.5 μM and pIC50 of 5.61 .
|
-
- HY-Y0790R
-
|
α-synuclein
|
Infection
Neurological Disease
Inflammation/Immunology
Cancer
|
Cuminaldehyde Standard is the analytical standard of Cuminaldehyde. This product is intended for research and analytical applications. Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC50= 0.00085 mg/mL) and α-glucosidase (IC50=0.5 mg/mL). Cuminaldehyde also inhibits the fibrillation of α-synuclein and prevents its aggregation Cuminaldehyde can induce apoptosis in colon adenocarcinoma cells by targeting topoisomerase I and II. In addition, Cuminaldehyde also exerts anti-inflammatory activity by inhibiting lipoxygenase. Cuminaldehyde has a strong inhibitory effect on the growth of Aspergillus flavus and the biosynthesis of aflatoxin B1 (AFB1). Cuminaldehyde can exert anti-injury and anti-neuropathy effects by participating in opioid receptors, L-arginine/NO/cGMP pathways and anti-inflammatory effects. Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .
|
-
- HY-107620
-
|
MEK
|
Neurological Disease
|
PD 198306 is a selective MAPK/ERK-kinase (MEK) inhibitor. PD 198306 results in an observable reduction in the Streptozocin induced increase in the level of active ERK1 and 2. Antihyperalgesic effects .
|
-
- HY-122575
-
|
P2X Receptor
Influenza Virus
Topoisomerase
MicroRNA
Apoptosis
|
Infection
Neurological Disease
Inflammation/Immunology
|
Aurintricarboxylic acid is a nanomolar-potency, allosteric antagonist with selectivity towards αβ-methylene-ATP-sensitive P2X1Rs and P2X3Rs, with IC50s of 8.6 nM and 72.9 nM for rP2X1R and rP2X3R, respectively . Aurintricarboxylic acid is a potent anti-influenza agent by directly inhibiting the neuraminidase . Aurintricarboxylic acid is an inhibitor of topoisomerase II and apoptosis . Aurintricarboxylic acid is a selective inhibitor of the TWEAK-Fn14 signaling pathway . Aurintricarboxylic acid also acts as a cystathionine-lyase (CSE) inhibitor with an IC50 of 0.6 μM . Aurintricarboxylic acid is a modifier of miRNAs that regulate miRNA function, with an IC50 of 0.47 µM .
|
-
Cat. No. |
Product Name |
Type |
-
- HY-B1661
-
Hexone chloride
|
Biochemical Assay Reagents
|
Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.
|
Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P0244
-
-
- HY-P3618
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-P1220A
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1626
-
|
Opioid Receptor
|
Neurological Disease
|
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .
|
-
- HY-P3431
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P3431A
-
|
iGluR
|
Neurological Disease
|
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .
|
-
- HY-P1129
-
|
Neuropeptide Y Receptor
|
Neurological Disease
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
-
- HY-P0244A
-
-
- HY-P2150
-
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-P1220
-
|
Sodium Channel
|
Neurological Disease
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P3223
-
|
Opioid Receptor
|
Neurological Disease
|
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .
|
Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
-
- HY-P0244
-
-
-
- HY-N5142
-
-
-
- HY-N3710
-
-
-
- HY-N0630
-
-
-
- HY-W097625
-
-
-
- HY-121239
-
|
Structural Classification
Natural Products
Animals
Source classification
|
NF-κB
|
Lemnalol is a potent agent for neuropathic pain. Lemnalol possesses potent anti-inflammatory, analgesic and anti-tumor activities. Lemnalol has the capacity to attenuate hyperalgesia and allodynia by modulation of neuroinflammatory processes in neuropathy. Lemnalol modulates LPS-induced alterations of left atrial (LA) calcium homeostasis and blocks the NF-κB pathways, which may contribute to the attenuation of lipopolysaccharide (LPS)-induced arrhythmogenesis and neuropathic pain. Lemnalolis a ylangene-type sesquiterpenoid compound, isolated from Lemnalia cervicorni .
|
-
-
- HY-P0244A
-
-
-
- HY-N0630R
-
-
-
- HY-N2573
-
-
-
- HY-W028263
-
-
-
- HY-N0478
-
-
-
- HY-N6967
-
(-)-α-Bisabolol
|
Structural Classification
other families
Terpenoids
Sesquiterpenes
Source classification
Plants
|
Apoptosis
|
Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .
|
-
-
- HY-N0405
-
-
-
- HY-N6967R
-
|
Structural Classification
other families
Terpenoids
Sesquiterpenes
Source classification
Plants
|
Apoptosis
|
Levomenol (Standard) is the analytical standard of Levomenol. This product is intended for research and analytical applications. Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .
|
-
-
- HY-N2071
-
-
-
- HY-N0405R
-
-
-
- HY-N2071R
-
|
Structural Classification
Cedrus deodara (Roxburgh) G. Don
Pinaceae
Terpenoids
Sesquiterpenes
Source classification
Plants
|
Cytochrome P450
Fungal
Apoptosis
Caspase
|
Cedrol (Standard) is the analytical standard of Cedrol. This product is intended for research and analytical applications. Cedrol is a potent competitive inhibitor of cytochrome P-450(CYP) enzyme. Cedrol plays an anticancer role by inducing cell cycle arrest and Caspase-dependent apoptosis. Cedrol acts as a neutrophil agonist that can desensitize cells to subsequent stimulation of N-formyl peptides. Cedrol prevents neuropathic pain caused by chronic contractile injury by inhibiting oxidative stress and inflammation. In addition, Cedrol has antibacterial, hair loss prevention and anti-anxiety properties.
|
-
-
- HY-Y0790
-
p-Isopropylbenzaldehyde
|
Structural Classification
Classification of Application Fields
Ketones, Aldehydes, Acids
Rudbeckia laciniata L.
Source classification
Umbelliferae
Plants
Endogenous metabolite
Disease Research Fields
Cancer
|
α-synuclein
|
Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC50= 0.00085 mg/mL), α-glucosidase (IC50=0.5 mg/mL) and lipoxygenase (IC50=1370 μM). Cuminaldehyde also inhibits the fibrillation of α-synuclein and prevents its aggregation. Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .
|
-
-
- HY-N0131
-
-
-
- HY-17387
-
-
-
- HY-Y0790R
-
|
Structural Classification
Ketones, Aldehydes, Acids
Rudbeckia laciniata L.
Source classification
Umbelliferae
Plants
Endogenous metabolite
|
α-synuclein
|
Cuminaldehyde Standard is the analytical standard of Cuminaldehyde. This product is intended for research and analytical applications. Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC50= 0.00085 mg/mL) and α-glucosidase (IC50=0.5 mg/mL). Cuminaldehyde also inhibits the fibrillation of α-synuclein and prevents its aggregation Cuminaldehyde can induce apoptosis in colon adenocarcinoma cells by targeting topoisomerase I and II. In addition, Cuminaldehyde also exerts anti-inflammatory activity by inhibiting lipoxygenase. Cuminaldehyde has a strong inhibitory effect on the growth of Aspergillus flavus and the biosynthesis of aflatoxin B1 (AFB1). Cuminaldehyde can exert anti-injury and anti-neuropathy effects by participating in opioid receptors, L-arginine/NO/cGMP pathways and anti-inflammatory effects. Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .
|
-
Cat. No. |
Product Name |
Chemical Structure |
-
- HY-A0057S
-
|
Gabapentin-d4 is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.
|
-
-
- HY-B0563S1
-
|
Ropivacaine-d7 is deuterium labeled Ropivacaine. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese[1][2]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane[3]. Ropivacaine is used for the research of neuropathic pain management[1].
|
-
-
- HY-B0563BS
-
|
Ropivacaine-d7 hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B) . Ropivacaine hydrochloride is a potent sodium channel blocker and blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese . Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for neuropathic pain management in vivo .
|
-
-
- HY-B0161ES
-
|
(±)-Duloxetine-d3 (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research[1].
|
-
-
- HY-A0057AS2
-
|
Gabapentin-d4 hydrochloride is the deuterium labeled Gabapentin hydrochloride (HY-A0057A). Gabapentin hydrochloride is a potent, orally active P/Q type Ca 2+ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca 2+ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .
|
-
-
- HY-16935S
-
|
Mavatrep-d6 (JNJ-39439335-d6) is a deuterated labeled Mavatrep (HY-16935). Mavatrep (JNJ-39439335) is an orally active, selective and potent TRPV1 antagonist with high affinity for hTRPV1 channels (Ki=6.5 nM). Mavatrep antagonizes capsaicin-induced Ca 2+ influx with an IC50 value of 4.6 nM. Mavatrep can be used in some studies of neuropathic pain .
|
-
-
- HY-17387S1
-
|
(-)-Huperzine A-d4 hydrochloride is deuterated labeled (-)-Huperzine A (HY-17387). (-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC50 of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .
|
-
Cat. No. |
Product Name |
|
Classification |
-
- HY-151391
-
|
|
Alkynes
|
LPA5 antagonist 1 (Compound 66) is a potent and selective lysophosphatidic acid receptor 5 (LPA5) antagonist (IC50=32 nM). LPA5 antagonist 1 shows high brain permeability and anti-nociceptive activity. LPA5 antagonist 1 can be used in inflammatory and neuropathic pain research . LPA5 antagonist 1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.
|
-
- HY-159113
-
|
|
Azide
|
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .
|
Cat. No. |
Product Name |
|
Classification |
-
- HY-N0131
-
|
|
Cholesterol
|
Stigmasterol is an orally acitve, immunomodulatory agent with anti-inflammatory and neuroprotective effect, as well as able to cross the blood-brain barrier. Stigmasterol activates AMPK, which in turn inhibits NF-κB and NLRP3 signaling pathways, reduces microglia-mediated neuroinflammation, and alleviates cognitive impairment and Alzheimer's disease. Stigmasterol regulates M1/M2 polarization of microglia through the TLR4/ NF-κB pathway, thereby reducing neuropathic pain. Stigmasterol can be used for neurodegenerative diseases, inflammatory diseases, and pain management, among others .
|
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent: