Search Result

Results for "

neuropathic

" in MedChemExpress (MCE) Product Catalog:

By Targets:	5-HT Receptor (3) AAK1 (11) Adenosine Kinase (1) Adenosine Receptor (6) Adrenergic Receptor (2) Aminopeptidase (2) Angiotensin Receptor (2) Antibiotic (1) Apoptosis (16) Arrestin (2) Autophagy (7) Biochemical Assay Reagents (2) Calcium Channel (13) Cannabinoid Receptor (11) Caspase (2) Cathepsin (1) CCR (2) CGRP Receptor (1) Cholinesterase (ChE) (2) COX (5) CXCR (3) Cyclin G-associated Kinase (GAK) (3) Cytochrome P450 (2) DNA/RNA Synthesis (2) Dopamine Receptor (1) Endogenous Metabolite (2) Epigenetic Reader Domain (1) Epoxide Hydrolase (1) ERK (3) FAAH (5) Fungal (4) GABA Receptor (4) GCGR (2) GPR55 (2) GPR84 (1) HDAC (3) Histamine Receptor (6) HSV (2) iGluR (14) Indoleamine 2,3-Dioxygenase (IDO) (1) Influenza Virus (1) Insulin Receptor (1) Interleukin Related (4) JAK (1) Keap1-Nrf2 (1) Lipoxygenase (3) mAChR (2) MAGL (4) MARK (1) Mas-related G-protein-coupled Receptor (MRGPR) (3) MEK (1) mGluR (5) MicroRNA (1) Mitophagy (2) Monoamine Oxidase (1) Necroptosis (1) Neprilysin (1) Neuropeptide Y Receptor (1) NF-κB (1) NO Synthase (3) Opioid Receptor (11) P2X Receptor (7) P2Y Receptor (4) PACAP Receptor (1) Parasite (1) Phosphodiesterase (PDE) (3) Phospholipase (1) Platelet-activating Factor Receptor (PAFR) (1) Potassium Channel (11) SARS-CoV (1) Serotonin Transporter (2) Sigma Receptor (10) Sodium Channel (23) Somatostatin Receptor (2) TNF Receptor (4) Topoisomerase (1) Trk Receptor (1) TRP Channel (12) Wnt (1) α-synuclein (2) β-catenin (1)
By Research Areas:	Cancer (43) Cardiovascular Disease (17) Endocrinology (3) Infection (10) Inflammation/Immunology (52) Metabolic Disease (8) Neurological Disease (186)
Click Chemistry:	Azide (1) Alkynes (1)

213

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

Natural
Products

Click Chemistry

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-100771

PCC0208009	Indoleamine 2,3-Dioxygenase (IDO)	Cardiovascular Disease
PCC0208009 is a potent IDO inhibitor with an IC₅₀ value of 4.52 nM in HeLa cell. PCC0208009 alleviates neuropathic pain and comorbidities by regulating synaptic plasticity of anterior cingulate cortex (ACC) and amygdala .

HY-125079

DSP-2230	Sodium Channel	Cardiovascular Disease Neurological Disease
DSP-2230 is a selective Nav1.7/Nav1.8 blocker, can be used to improve neuropathic pain .

HY-131004

CB2R PAM	Cannabinoid Receptor	Neurological Disease
CB2R PAM is an orally active cannabinoid type-2 receptors (CB2Rs) positive allosteric modulator. CB2R PAM displays antinociceptive activity in vivo in an experimental mouse model of neuropathic pain .

HY-100080

A-887826	Sodium Channel	Neurological Disease
A-887826 is a potent, selective, oral bioavailable and voltage-dependent Na(v)1.8 sodium channel blocker with an IC₅₀ of 11 nM . A-887826 attenuates neuropathic tactile allodynia in vivo .

HY-110036

GW-405833 L768242	Cannabinoid Receptor	Neurological Disease Inflammation/Immunology
GW-405833 (L768242) is a potent, selective cannabinoid receptor 2 (CB₂) agonist with an EC₅₀ of 50.7 nM. GW-405833 also behaves as a noncompetitive CB₁ antagonist. GW-405833 suppresses inflammatory and neuropathic pain .

HY-106186

GW-493838	Adenosine Receptor	Neurological Disease
GW-493838 is a potent Adenosine A1 (A1AR) agonist. GW-493838 has the potential for the research of neuropathic pain .

HY-12909

MK-4409	FAAH	Neurological Disease Inflammation/Immunology
MK-4409 is a potent oxazole FAAH inhibitor and can be used for the research of inflammatory and neuropathic pain .

HY-159113

PCC0105003	MARK	Neurological Disease
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .

HY-124382

AS1928370	TRP Channel	Neurological Disease
AS1928370 is a novel and central nervous system (CNS) penetrant TRPV1 antagonist and can prevent ligand-induced activation in vivo. AS1928370 is a promising agent for neuropathic pain treatment research .

HY-113608

VCP171	Adenosine Receptor	Neurological Disease
VCP171 is a potent adenosine A1 receptor (A1R) positive allosteric modulator (PAM). VCP171 is effective at decreasing excitatory synaptic currents in Lamina II of neuropathic pain model. VCP171 can be used for researching neuropathic pain .

HY-12122

AR-C102222	NO Synthase	Neurological Disease
AR-C102222 is a spirocyclic fluoropiperidine quinazoline selective iNOS inhibitor. AR-C102222 can be used for the research of neuropathic pain .

HY-143263

FAAH/MAGL-IN-1	FAAH MAGL	Neurological Disease
FAAH/MAGL-IN-1 (compound SIH 3) is a potent FAAH and MAGL inhibitor with IC₅₀s of 31 nM and 29 nM, respectively. FAAH/MAGL-IN-1 has the potential for the research of neuropathic pain .

HY-103344

ZJ43	Aminopeptidase mGluR	Neurological Disease Inflammation/Immunology
ZJ43 is a potent NAAG peptidase inhibitor, with an IC₅₀ of 2.4 nM and a K_i of 0.8 nM. ZJ43 sufficiently activates group II mGluR and reduces some of the behavioral effects of PCP. ZJ43 shows an analgesic effect in neuropathic and inflammatory and pain models .

HY-14897

Rezatomidine AGN-203818	Adrenergic Receptor	Neurological Disease Metabolic Disease
Rezatomidine (AGN-203818) is a potent and selective α2-AR agonist. Rezatomidine can be used for diabetic neuropathy and neuropathic pain research .

HY-15451

MDA 19 1 Publications Verification	Cannabinoid Receptor	Neurological Disease
MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a K_i of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .

HY-B0161E

(±)-Duloxetine hydrochloride (Rac)-Duloxetine hydrochloride	Serotonin Transporter	Neurological Disease
(±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research .

HY-106010

LBP1	Cannabinoid Receptor	Neurological Disease
LBP1 is an orally active and low brain penetrant CB1 receptor agonist. LBP1 exhibits significant anti-allodynic and anti-hyperalgesic effects in rodent models of neuropathic pain .

HY-147306

ZLc-002	Others	Neurological Disease
ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain. ZLc-002 can be used for the research of anxiety disorder and inflammation .

HY-B0246

Carbamazepine 10+ Cited Publications CBZ; NSC 169864	Sodium Channel Autophagy Mitophagy Potassium Channel Calcium Channel HDAC	Neurological Disease Cancer
Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC₅₀ of 131 μM. Carbamazepine blocks voltage gated Na ⁺, Ca ²⁺, and K ⁺ channels, and is also a HDAC inhibitor (IC₅₀: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .

HY-117714

AZD-3161	Sodium Channel	Neurological Disease
AZD-3161 is a potent and selective blocker of Na_V1.7 channel, with a pIC₅₀ of 7.1. AZD-3161 can be used for the research of neuropathic and inflammatory pain .

HY-162759

Sigma-1 receptor antagonist 6	Sigma Receptor	Neurological Disease
Sigma-1 receptor antagonist 6 (Compound 12) is an antagonist of the Sigma-1 receptor (σ1R). Sigma-1 receptor antagonist 6 exerts a robust antiallodynic effect by antagonizing σ1R. Sigma-1 receptor antagonist 6 can be used in neuropathic pain animal models to alleviate mechanical allodynia induced by paclitaxel (HY-B0015) .

HY-155616

KSK94	Sigma Receptor Histamine Receptor	Neurological Disease
KSK94 is a high-affinity histamine H3 receptor antagonist, with K_is of 7.9, 2958, 75.2 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK94 can be used for research of nociceptive and neuropathic pain .

HY-132133

Nav1.8-IN-1	Sodium Channel	Neurological Disease Inflammation/Immunology
Nav1.8-IN-1 (Compound 31) is a potent inhibitor of Na(v)1.8 sodium channel. Nav1.8-IN-1 has the potential for the research of inflammatory and neuropathic pain .

HY-19636

JNJ-42165279	FAAH Autophagy	Neurological Disease
JNJ-42165279 is an orally active FAAH inhibitor, with IC₅₀ values of 70 nM for hFAAH and 313 nM for rFAAH. JNJ-42165279 can be used in research related to the field of neuropathic pain .

HY-143879

MRGPRX1 agonist 3	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 3 (compound 1f) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.22 μM. MRGPRX1 agonist 3 can be used for researching neuropathic pain .

HY-A0057

Gabapentin 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .

HY-A0057A

Gabapentin hydrochloride 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin hydrochloride is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .

HY-155615

KSK67	Sigma Receptor Histamine Receptor	Neurological Disease
KSK67 is a high-affinity dual sigma-2 and histamine H3 receptor antagonist, with K_is of 3.2, 1531, 101 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK67 can be used for research of nociceptive and neuropathic pain .

HY-161914

P2X3 antagonist 39	P2X Receptor	Neurological Disease
P2X3 antagonist 39 (compound 26a) is a selective P2X3 receptor antagonist with an IC₅₀ value of 54.9 nM. P2X3 antagonist 39 can be used in the study of neuropathic pain model .

HY-B0246R

Carbamazepine (Standard)	Sodium Channel Autophagy Mitophagy Potassium Channel Calcium Channel HDAC	Neurological Disease Cancer
Carbamazepine (Standard) is the analytical standard of Carbamazepine. This product is intended for research and analytical applications. Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC₅₀ of 131 μM. Carbamazepine blocks voltage gated Na ⁺, Ca ²⁺, and K ⁺ channels, and is also a HDAC inhibitor (IC₅₀: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .

HY-14900

Tedalinab GRC-10693	Cannabinoid Receptor	Inflammation/Immunology
Tedalinab (GRC-10693) is a potent, orally active, and selective cannabinoid receptor 2 (CB2) agonist. Tedalinab has >4700-fold functional selectivity for CB2 over CB1. Tedalinab has potential for neuropathic pain and osteoarthritis treatment .

HY-15451R

MDA 19 (Standard)	Cannabinoid Receptor	Neurological Disease
MDA 19 (Standard) is the analytical standard of MDA 19. This product is intended for research and analytical applications. MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a Ki of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .

HY-143878

MRGPRX1 agonist 2	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 2 (compound 1a) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.48 μM. MRGPRX1 agonist 2 can be used for researching neuropathic pain .

HY-121239

Lemnalol	NF-κB	Neurological Disease Inflammation/Immunology Cancer
Lemnalol is a potent agent for neuropathic pain. Lemnalol possesses potent anti-inflammatory, analgesic and anti-tumor activities. Lemnalol has the capacity to attenuate hyperalgesia and allodynia by modulation of neuroinflammatory processes in neuropathy. Lemnalol modulates LPS-induced alterations of left atrial (LA) calcium homeostasis and blocks the NF-κB pathways, which may contribute to the attenuation of lipopolysaccharide (LPS)-induced arrhythmogenesis and neuropathic pain. Lemnalolis a ylangene-type sesquiterpenoid compound, isolated from Lemnalia cervicorni .

HY-117091

DDD-028	Others	Neurological Disease Inflammation/Immunology
DDD-028 is a potent non-opioid, non-cannabinoid analgesic which attenuates neuropathic and inflammatory pain without the possible side effects or abuse potential associated with opioid or cannabinoid activities. DDD-028 can be utilized in analgesic research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-155614

KSK68	Sigma Receptor Histamine Receptor	Neurological Disease
KSK68 is a high-affinity dual sigma-1 and histamine H3 receptor antagonist, with K_is of 7.7, 3.6, 22.4 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK68 has negligible affinity at the other histamine receptor subtypes. KSK68 can be used for research of nociceptive and neuropathic pain .

HY-156684

GDC-6599	TRP Channel	Neurological Disease
GDC-6599 is an orally active TRPA1 inhibitor, with IC₅₀ values of 5.3 nM in humans, 6.6 nM in rats, 9.3 nM in dogs, 7.2 nM in monkeys, and 15 nM in guinea pigs. GDC-6599 can be used in the research of neuropathic pain and respiratory diseases such as asthma and chronic cough .

HY-15078

NS1219 (R)-SPD502	iGluR	Neurological Disease
NS1219 ((R)-SPD502) is the isomer of NS 1209 HY-15074. NS1209 is a selective AMPA receptor antagonist with neuroprotective activity. NS1209 can be used for the research of stroke, neuropathic pain and epilepsy .

HY-A0057R

Gabapentin (Standard)	Calcium Channel	Neurological Disease Cancer
Gabapentin (Standard) is the analytical standard of Gabapentin. This product is intended for research and analytical applications. Gabapentin is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-143880

MRGPRX1 agonist 4	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain .

HY-144301

AAK1-IN-2	AAK1	Neurological Disease
AAK1-IN-2 (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 can be used for the research of neuropathic pain .

HY-107656

PTAC oxalate	mAChR	Neurological Disease
PTAC oxalate is a selective muscarinic receptor ligand. PTAC oxalate is an partial agonist of M2 and M4 but antagonist of M1, M3, and M5 (K_i values of 0.2-2.8 nM for hM1-5 in CHO cells). PTAC oxalate alleviates the mechanical allodynia on the neuropathic pain and has antidepression effects .

HY-144301A

AAK1-IN-2 TFA	AAK1	Neurological Disease
AAK1-IN-2 TFA (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 TFA can be used for the research of neuropathic pain .

HY-108449

Acoltremon 1 Publications Verification WS-12; AR-15512; AVX-012	TRP Channel	Cancer
Acoltremon (WS-12; AR-15512) is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research .

HY-133130

JNJ-42226314	MAGL	Neurological Disease
JNJ-42226314 is a competitive, highly selective and reversible non-covalent monoacylglycerol lipase (MAGL) inhibitor. JNJ-42226314 demonstrates dose-dependent enhancement of the major endocannabinoid 2-arachidonoylglycerol (2-AG) as well as efficacy in models of neuropathic and inflammatory pain .

HY-19876

PL37 Debio-0827	Opioid Receptor Aminopeptidase Neprilysin	Neurological Disease Metabolic Disease
PL37 (Debio-0827) is an orally active Enkephalinase dual inhibitor (dual inhibition refers to the simultaneous inhibition of Neutral Endopeptidase and Aminopeptidase N activities). PL37 exerts its anti-hyperalgesic effects by activating μ-opioid receptors (µ-opioid receptors), with an ED₅₀ value of 13.4 mg/kg for analgesic effects in mice. PL37 can be used to study diabetic neuropathic pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-P0244

Dermorphin	Opioid Receptor	Neurological Disease
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

Cat. No.	Product Name	Type

HY-B1661

Hexamethonium chloride

Hexone chloride

Biochemical Assay Reagents

Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.

Cat. No.	Product Name	Target	Research Area

HY-P0244

Dermorphin	Opioid Receptor	Neurological Disease
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P3618

Cortistatin-29 (reduced)	Somatostatin Receptor	Neurological Disease Inflammation/Immunology
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC₅₀ values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .

HY-P1220A

Huwentoxin-IV TFA	Sodium Channel	Neurological Disease
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-P1626

Acetyl tetrapeptide-15	Opioid Receptor	Neurological Disease
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-P0244A

Dermorphin TFA	Opioid Receptor	Neurological Disease
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P2150

Cortistatin-29	Somatostatin Receptor	Neurological Disease Inflammation/Immunology
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC₅₀ values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .

HY-P1220

Huwentoxin-IV	Sodium Channel	Neurological Disease
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-P3223

Biphalin TFA	Opioid Receptor	Neurological Disease
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .

Cat. No.	Product Name		Classification

HY-151391

LPA5 antagonist 1		Alkynes
LPA5 antagonist 1 (Compound 66) is a potent and selective lysophosphatidic acid receptor 5 (LPA5) antagonist (IC₅₀=32 nM). LPA5 antagonist 1 shows high brain permeability and anti-nociceptive activity. LPA5 antagonist 1 can be used in inflammatory and neuropathic pain research . LPA5 antagonist 1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-159113

PCC0105003		Azide
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

neuropathic

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

NaturalProducts

Click Chemistry

Natural
Products