Search Result

Results for "

neuropathic

" in MedChemExpress (MCE) Product Catalog:

By Targets:	5-HT Receptor (3) AAK1 (10) Adenosine Kinase (1) Adenosine Receptor (6) Adrenergic Receptor (2) Aminopeptidase (2) Angiotensin Receptor (2) Antibiotic (1) Apoptosis (12) Arrestin (2) Autophagy (4) Biochemical Assay Reagents (1) Calcium Channel (13) Cannabinoid Receptor (11) Cathepsin (1) CCR (2) CGRP Receptor (1) Cholinesterase (ChE) (3) COX (5) CXCR (3) Cyclin G-associated Kinase (GAK) (3) DNA/RNA Synthesis (2) Dopamine Receptor (1) Endogenous Metabolite (2) Epigenetic Reader Domain (1) Epoxide Hydrolase (1) FAAH (5) Fungal (2) GABA Receptor (4) GCGR (2) GPR55 (2) GPR84 (1) HDAC (3) Histamine Receptor (6) HSV (2) iGluR (15) Indoleamine 2,3-Dioxygenase (IDO) (1) Influenza Virus (1) Insulin Receptor (1) Interleukin Related (4) Isotope-Labeled Compounds (5) JAK (1) Keap1-Nrf2 (1) Lipoxygenase (3) mAChR (2) MAGL (4) MARK (1) Mas-related G-protein-coupled Receptor (MRGPR) (3) MEK (1) mGluR (5) MicroRNA (1) Mitophagy (2) Monoamine Oxidase (1) Necroptosis (1) Neprilysin (1) Neuropeptide Y Receptor (1) NF-κB (1) NO Synthase (3) Opioid Receptor (11) P2X Receptor (7) P2Y Receptor (2) PACAP Receptor (1) Parasite (1) PARP (1) Phosphodiesterase (PDE) (2) Phospholipase (1) Potassium Channel (11) SARS-CoV (1) Serotonin Transporter (3) Sigma Receptor (10) Sodium Channel (23) Somatostatin Receptor (2) TNF Receptor (4) Topoisomerase (1) Trk Receptor (1) TRP Channel (13) Wnt (1) α-synuclein (2) β-catenin (1)
By Research Areas:	Cancer (36) Cardiovascular Disease (17) Endocrinology (3) Infection (8) Inflammation/Immunology (47) Metabolic Disease (8) Neurological Disease (184)
Click Chemistry:	Azide (1) Alkynes (1)

208

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

Natural
Products

Isotope-Labeled Compounds

Click Chemistry

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-100771

PCC0208009	Indoleamine 2,3-Dioxygenase (IDO)	Cardiovascular Disease
PCC0208009 is a potent IDO inhibitor with an IC₅₀ value of 4.52 nM in HeLa cell. PCC0208009 alleviates neuropathic pain and comorbidities by regulating synaptic plasticity of anterior cingulate cortex (ACC) and amygdala .

HY-131004

CB2R PAM	Cannabinoid Receptor	Neurological Disease
CB2R PAM is an orally active cannabinoid type-2 receptors (CB2Rs) positive allosteric modulator. CB2R PAM displays antinociceptive activity in vivo in an experimental mouse model of neuropathic pain .

HY-100080

A-887826	Sodium Channel	Neurological Disease
A-887826 is a potent, selective, oral bioavailable and voltage-dependent Na(v)1.8 sodium channel blocker with an IC₅₀ of 11 nM . A-887826 attenuates neuropathic tactile allodynia in vivo .

HY-110036

GW-405833 L768242	Cannabinoid Receptor	Neurological Disease Inflammation/Immunology
GW-405833 (L768242) is a potent, selective cannabinoid receptor 2 (CB₂) agonist with an EC₅₀ of 50.7 nM. GW-405833 also behaves as a noncompetitive CB₁ antagonist. GW-405833 suppresses inflammatory and neuropathic pain .

HY-106186

GW-493838	Adenosine Receptor	Neurological Disease
GW-493838 is a potent Adenosine A1 (A1AR) agonist. GW-493838 has the potential for the research of neuropathic pain .

HY-12909

MK-4409	FAAH	Neurological Disease Inflammation/Immunology
MK-4409 is a potent oxazole FAAH inhibitor and can be used for the research of inflammatory and neuropathic pain .

HY-159113

PCC0105003	MARK	Neurological Disease
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .

HY-124382

AS1928370	TRP Channel	Neurological Disease
AS1928370 is a novel and central nervous system (CNS) penetrant TRPV1 antagonist and can prevent ligand-induced activation in vivo. AS1928370 is a promising agent for neuropathic pain treatment research .

HY-113608

VCP171	Adenosine Receptor	Neurological Disease
VCP171 is a potent adenosine A1 receptor (A1R) positive allosteric modulator (PAM). VCP171 is effective at decreasing excitatory synaptic currents in Lamina II of neuropathic pain model. VCP171 can be used for researching neuropathic pain .

HY-12122

AR-C102222	NO Synthase	Neurological Disease
AR-C102222 is a spirocyclic fluoropiperidine quinazoline selective iNOS inhibitor. AR-C102222 can be used for the research of neuropathic pain .

HY-143263

FAAH/MAGL-IN-1	FAAH MAGL	Neurological Disease
FAAH/MAGL-IN-1 (compound SIH 3) is a potent FAAH and MAGL inhibitor with IC₅₀s of 31 nM and 29 nM, respectively. FAAH/MAGL-IN-1 has the potential for the research of neuropathic pain .

HY-103344

ZJ43	Aminopeptidase mGluR	Neurological Disease Inflammation/Immunology
ZJ43 is a potent NAAG peptidase inhibitor, with an IC₅₀ of 2.4 nM and a K_i of 0.8 nM. ZJ43 sufficiently activates group II mGluR and reduces some of the behavioral effects of PCP. ZJ43 shows an analgesic effect in neuropathic and inflammatory and pain models .

HY-14897

Rezatomidine AGN-203818	Adrenergic Receptor	Neurological Disease Metabolic Disease
Rezatomidine (AGN-203818) is a potent and selective α2-AR agonist. Rezatomidine can be used for diabetic neuropathy and neuropathic pain research .

HY-145584

Nesuparib JPI-547/OCN-201	PARP	Cardiovascular Disease Neurological Disease
Nesuparib is a potent inhibitor of PARP. Nesuparib is useful for the research of neuropathic pain, neurodegenerative disease, and cardiovascular disease (extracted from patent WO2016200101A2) .

HY-15451

MDA 19 1 Publications Verification	Cannabinoid Receptor	Neurological Disease
MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a K_i of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .

HY-B0161E

(±)-Duloxetine hydrochloride (Rac)-Duloxetine hydrochloride	Serotonin Transporter	Neurological Disease
(±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research .

HY-106010

LBP1	Cannabinoid Receptor	Neurological Disease
LBP1 is an orally active and low brain penetrant CB1 receptor agonist. LBP1 exhibits significant anti-allodynic and anti-hyperalgesic effects in rodent models of neuropathic pain .

HY-147306

ZLc-002	Others	Neurological Disease
ZLc-002 is a selective inhibitor of nNOS-Capon coupling. ZLc-002 suppresses inflammatory nociception and chemotherapy-induced neuropathic pain. ZLc-002 can be used for the research of anxiety disorder and inflammation .

HY-B0246

Carbamazepine 10+ Cited Publications CBZ; NSC 169864	Sodium Channel Autophagy Mitophagy Potassium Channel Calcium Channel HDAC	Neurological Disease Cancer
Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC₅₀ of 131 μM. Carbamazepine blocks voltage gated Na ⁺, Ca ²⁺, and K ⁺ channels, and is also a HDAC inhibitor (IC₅₀: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .

HY-117714

AZD-3161	Sodium Channel	Neurological Disease
AZD-3161 is a potent and selective blocker of Na_V1.7 channel, with a pIC₅₀ of 7.1. AZD-3161 can be used for the research of neuropathic and inflammatory pain .

HY-162759

Sigma-1 receptor antagonist 6	Sigma Receptor	Neurological Disease
Sigma-1 receptor antagonist 6 (Compound 12) is an antagonist of the Sigma-1 receptor (σ1R). Sigma-1 receptor antagonist 6 exerts a robust antiallodynic effect by antagonizing σ1R. Sigma-1 receptor antagonist 6 can be used in neuropathic pain animal models to alleviate mechanical allodynia induced by paclitaxel (HY-B0015) .

HY-155616

KSK94	Sigma Receptor Histamine Receptor	Neurological Disease
KSK94 is a high-affinity histamine H3 receptor antagonist, with K_is of 7.9, 2958, 75.2 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK94 can be used for research of nociceptive and neuropathic pain .

HY-132133

Nav1.8-IN-1	Sodium Channel	Neurological Disease Inflammation/Immunology
Nav1.8-IN-1 (Compound 31) is a potent inhibitor of Na(v)1.8 sodium channel. Nav1.8-IN-1 has the potential for the research of inflammatory and neuropathic pain .

HY-19636

JNJ-42165279	FAAH Autophagy	Neurological Disease
JNJ-42165279 is an orally active FAAH inhibitor, with IC₅₀ values of 70 nM for hFAAH and 313 nM for rFAAH. JNJ-42165279 can be used in research related to the field of neuropathic pain .

HY-143879

MRGPRX1 agonist 3	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 3 (compound 1f) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.22 μM. MRGPRX1 agonist 3 can be used for researching neuropathic pain .

HY-A0057

Gabapentin 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .

HY-A0057A

Gabapentin hydrochloride 5+ Cited Publications	Calcium Channel	Neurological Disease Cancer
Gabapentin hydrochloride is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .

HY-155615

KSK67	Sigma Receptor Histamine Receptor	Neurological Disease
KSK67 is a high-affinity dual sigma-2 and histamine H3 receptor antagonist, with K_is of 3.2, 1531, 101 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK67 can be used for research of nociceptive and neuropathic pain .

HY-161914

P2X3 antagonist 39	P2X Receptor	Neurological Disease
P2X3 antagonist 39 (compound 26a) is a selective P2X3 receptor antagonist with an IC₅₀ value of 54.9 nM. P2X3 antagonist 39 can be used in the study of neuropathic pain model .

HY-B0246R

Carbamazepine (Standard)	Sodium Channel Autophagy Mitophagy Potassium Channel Calcium Channel HDAC	Neurological Disease Cancer
Carbamazepine (Standard) is the analytical standard of Carbamazepine. This product is intended for research and analytical applications. Carbamazepine is an orally active pressure-sensitive sodium ion channel blocker with an IC₅₀ of 131 μM. Carbamazepine blocks voltage gated Na ⁺, Ca ²⁺, and K ⁺ channels, and is also a HDAC inhibitor (IC₅₀: 2 μM). Carbamazepine is an anticonvulsant and can be used for research of epilepsy and neuropathic pain .

HY-14900

Tedalinab GRC-10693	Cannabinoid Receptor	Inflammation/Immunology
Tedalinab (GRC-10693) is a potent, orally active, and selective cannabinoid receptor 2 (CB2) agonist. Tedalinab has >4700-fold functional selectivity for CB2 over CB1. Tedalinab has potential for neuropathic pain and osteoarthritis treatment .

HY-15451R

MDA 19 (Standard)	Cannabinoid Receptor	Neurological Disease
MDA 19 (Standard) is the analytical standard of MDA 19. This product is intended for research and analytical applications. MDA 19 is a potent and selective agonist of human cannabinoid receptor 2 (CB2), with a Ki of 43.3 nM. MDA 19 has antiallodynic effects in a rat model of neuropathic pain and does not affect rat locomotor activity .

HY-143878

MRGPRX1 agonist 2	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 2 (compound 1a) is a potent Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.48 μM. MRGPRX1 agonist 2 can be used for researching neuropathic pain .

HY-121239

Lemnalol	NF-κB	Neurological Disease Inflammation/Immunology Cancer
Lemnalol is a potent agent for neuropathic pain. Lemnalol possesses potent anti-inflammatory, analgesic and anti-tumor activities. Lemnalol has the capacity to attenuate hyperalgesia and allodynia by modulation of neuroinflammatory processes in neuropathy. Lemnalol modulates LPS-induced alterations of left atrial (LA) calcium homeostasis and blocks the NF-κB pathways, which may contribute to the attenuation of lipopolysaccharide (LPS)-induced arrhythmogenesis and neuropathic pain. Lemnalolis a ylangene-type sesquiterpenoid compound, isolated from Lemnalia cervicorni .

HY-117091

DDD-028	Others	Neurological Disease Inflammation/Immunology
DDD-028 is a potent non-opioid, non-cannabinoid analgesic which attenuates neuropathic and inflammatory pain without the possible side effects or abuse potential associated with opioid or cannabinoid activities. DDD-028 can be utilized in analgesic research .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-155614

KSK68	Sigma Receptor Histamine Receptor	Neurological Disease
KSK68 is a high-affinity dual sigma-1 and histamine H3 receptor antagonist, with K_is of 7.7, 3.6, 22.4 nM for H3 receptor, sigma-1, sigma-2 receptor respectively. KSK68 has negligible affinity at the other histamine receptor subtypes. KSK68 can be used for research of nociceptive and neuropathic pain .

HY-156684

GDC-6599	TRP Channel	Neurological Disease
GDC-6599 is an orally active TRPA1 inhibitor, with IC₅₀ values of 5.3 nM in humans, 6.6 nM in rats, 9.3 nM in dogs, 7.2 nM in monkeys, and 15 nM in guinea pigs. GDC-6599 can be used in the research of neuropathic pain and respiratory diseases such as asthma and chronic cough .

HY-15078

NS1219 (R)-SPD502	iGluR	Neurological Disease
NS1219 ((R)-SPD502) is the isomer of NS 1209 HY-15074. NS1209 is a selective AMPA receptor antagonist with neuroprotective activity. NS1209 can be used for the research of stroke, neuropathic pain and epilepsy .

HY-A0057R

Gabapentin (Standard)	Calcium Channel	Neurological Disease Cancer
Gabapentin (Standard) is the analytical standard of Gabapentin. This product is intended for research and analytical applications. Gabapentin is a potent, orally active P/Q type Ca2+ channel blocker. Gabapentin inhibits neuronal Ca2+ influx and reduction of neurotransmitter release. Gabapentin is a GABA analog that can be used to relieve neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-143880

MRGPRX1 agonist 4	Mas-related G-protein-coupled Receptor (MRGPR)	Neurological Disease
MRGPRX1 agonist 4 (compound 1t) is a potent and orally active Mas-related G protein-coupled receptor X1 (MRGPRX1) positive allosteric modulator with an EC₅₀ value of 0.1 μM. MRGPRX1 agonist 4 has good metabolic stability and oral bioavailability. MRGPRX1 agonist 4 can reduce behavioral heat hypersensitivity in a neuropathic pain model humanized MRGPRX1 mice. MRGPRX1 agonist 4 can be used for researching neuropathic pain .

HY-144301

AAK1-IN-2	AAK1	Neurological Disease
AAK1-IN-2 (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 can be used for the research of neuropathic pain .

HY-107656

PTAC oxalate	mAChR	Neurological Disease
PTAC oxalate is a selective muscarinic receptor ligand. PTAC oxalate is an partial agonist of M2 and M4 but antagonist of M1, M3, and M5 (K_i values of 0.2-2.8 nM for hM1-5 in CHO cells). PTAC oxalate alleviates the mechanical allodynia on the neuropathic pain and has antidepression effects .

HY-144301A

AAK1-IN-2 TFA	AAK1	Neurological Disease
AAK1-IN-2 TFA (compound (S)-31) is a potent, selective and brain-penetrant inhibitor of Adaptor Protein 2-Associated Kinase 1 (AAK1), with an IC₅₀ of 5.8 nM. AAK1-IN-2 TFA can be used for the research of neuropathic pain .

HY-108449

Acoltremon 1 Publications Verification WS-12; AR-15512; AVX-012	TRP Channel	Cancer
Acoltremon (WS-12; AR-15512) is a potent and selective TRPM8 agonist, the menthol derivative, as a cooling agent. Acoltremon shows analgesic effect, and can be used in chronic neuropathic pain research .

HY-133130

JNJ-42226314	MAGL	Neurological Disease
JNJ-42226314 is a competitive, highly selective and reversible non-covalent monoacylglycerol lipase (MAGL) inhibitor. JNJ-42226314 demonstrates dose-dependent enhancement of the major endocannabinoid 2-arachidonoylglycerol (2-AG) as well as efficacy in models of neuropathic and inflammatory pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-19876

PL37 Debio-0827	Opioid Receptor Aminopeptidase Neprilysin	Neurological Disease Metabolic Disease
PL37 (Debio-0827) is an orally active Enkephalinase dual inhibitor (dual inhibition refers to the simultaneous inhibition of Neutral Endopeptidase and Aminopeptidase N activities). PL37 exerts its anti-hyperalgesic effects by activating μ-opioid receptors (µ-opioid receptors), with an ED₅₀ value of 13.4 mg/kg for analgesic effects in mice. PL37 can be used to study diabetic neuropathic pain .

HY-P0244

Dermorphin	Opioid Receptor	Neurological Disease
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

Cat. No.	Product Name	Type

HY-B1661

Hexamethonium chloride

Hexone chloride

Biochemical Assay Reagents

Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.

Cat. No.	Product Name	Target	Research Area

HY-P0244

Dermorphin	Opioid Receptor	Neurological Disease
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P3618

Cortistatin-29 (reduced)	Somatostatin Receptor	Neurological Disease Inflammation/Immunology
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC₅₀ values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .

HY-P1220A

Huwentoxin-IV TFA	Sodium Channel	Neurological Disease
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-P1626

Acetyl tetrapeptide-15	Opioid Receptor	Neurological Disease
Acetyl tetrapeptide-15 is a synthetic peptide used in the cosmetics for sensitive skin. Acetyl tetrapeptide-15 is derived from endomorphin-2 (Tyr-Pro-Phe-Phe-NH2), a human μ-opioid agonist with selective anti-nociceptive effect. Acetyl tetrapeptide-15 reduces skin hyperreactivity producing inflammatory, chronic and neuropathic pain, by increasing the threshold of neuronal excitability in μ-opioid receptor via an endorphin-like pathway .

HY-P3431

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P3431A

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA	iGluR	Neurological Disease
VSGLNPSLWSIFGLQFILLWLVSGSRHYLW (TFA) is a 30-amino-acid peptide mimicking the C-terminal domain of α2δ-1, termed as α2δ-1Tat peptide. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can effectively interrupt the α2δ-1 - NMDAR interaction in vitro and in vivo. VSGLNPSLWSIFGLQFILLWLVSGSRHYLW can be used for researching neuropathic pain .

HY-P1129

AR-M1896	Neuropeptide Y Receptor	Neurological Disease
AR-M1896 is a GalR2 selective agonist with a binding IC₅₀ of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .

HY-P0244A

Dermorphin TFA	Opioid Receptor	Neurological Disease
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-P2150

Cortistatin-29	Somatostatin Receptor	Neurological Disease Inflammation/Immunology
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC₅₀ values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .

HY-P1220

Huwentoxin-IV	Sodium Channel	Neurological Disease
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC₅₀s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .

HY-P3223

Biphalin TFA	Opioid Receptor	Neurological Disease
Biphalin TFA, a BBB-penetrable opioid peptide analog, contains two active enkephalin pharmacophores. Biphalin TFA has high affinity for opioid receptors. Biphalin TFA shows analgesic effect in acute, neuropathic, and chronic animal pain models. Biphalin TFA is also an antiviral, antiproliferative, anti-inflammatory, and neuroprotective agent .

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-P0244

Dermorphin	Structural Classification Natural Products Animals Source classification Phenols Polyphenols	Opioid Receptor
Dermorphin is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-N3710

Dehydrocrenatidine Kumujian G; O-Methylpicrasidine I	Alkaloids Simaroubaceae Source classification Pyridine Alkaloids Plants	JAK Apoptosis
Dehydrocrenatidine, a natural alkaloid, is a specific JAK inhibitor. Dehydrocrenatidine inhibits voltage-gated sodium channels and ameliorates mechanic allodia in a rat model of neuropathic pain .

HY-N0630

Shanzhiside methyl ester	Structural Classification Iridoids Terpenoids Labiatae Phaseolus lunatus L. Source classification Plants	GCGR
Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance .

HY-W097625

6-Methoxyflavone	Structural Classification Flavonoids Flavones Thymelaeaceae Source classification Plants Pimelea simplex F.Muell.	Others
6-Methoxyflavone is a methoxyflavone that can be isolated from Pimelea simplex F. Muell. and P. decora Domin.. 6-Methoxyflavone exhibits anti-inflammatory effects and neuropathic pain relieving properties in chemotherapy-induced peripheral neuropathy (CIPN). 6-Methoxyflavone can be used in the research of nephritis .

HY-N0478

Neoline 1 Publications Verification Bullatine B	Alkaloids Piperidine Alkaloids Structural Classification other families Source classification Plants	Others
Neoline (Bullatine B)) is the active ingredient of the active ingredient (PA), which can be used to cure the disease. Neoline Flow Suppression Nav1.7 Electrical Flow Control (VGSC)，Improve diabetes mechanical pain sensitivity. Neoline has a list of compounds that can be used, research on its use, and the quality of its processing during processing in pain.

HY-121239

Lemnalol	Structural Classification Natural Products Animals Source classification	NF-κB
Lemnalol is a potent agent for neuropathic pain. Lemnalol possesses potent anti-inflammatory, analgesic and anti-tumor activities. Lemnalol has the capacity to attenuate hyperalgesia and allodynia by modulation of neuroinflammatory processes in neuropathy. Lemnalol modulates LPS-induced alterations of left atrial (LA) calcium homeostasis and blocks the NF-κB pathways, which may contribute to the attenuation of lipopolysaccharide (LPS)-induced arrhythmogenesis and neuropathic pain. Lemnalolis a ylangene-type sesquiterpenoid compound, isolated from Lemnalia cervicorni .

HY-P0244A

Dermorphin TFA	Structural Classification Animals Source classification Phenols Polyphenols	Opioid Receptor
Dermorphin TFA is a natural heptapeptide μ-opioid receptor (MOR) agonist found in amphibian skin. Inhibition of neuropathic pain .

HY-N0630R

Shanzhiside methyl ester (Standard)	Structural Classification Iridoids Terpenoids Labiatae Phaseolus lunatus L. Source classification Plants	GCGR
Shanzhiside methyl ester (Standard) is the analytical standard of Shanzhiside methyl ester. This product is intended for research and analytical applications. Shanzhiside methy lester is isolated from lamiophlomis rotata. Shanzhiside methyl ester is a small molecule glucagon-like peptide-1 (GLP-1) receptor agonist and has the ability to induce anti-allodynic tolerance .

HY-N2573

Corydalmine L-Corydalmine; TLZ-16	Alkaloids Monophenols Corydalis yanhusuo W. T. Wang Source classification Phenols Plants Isoquinoline Alkaloids Papaveraceae	Fungal CXCR
Corydalmine (L-Corydalmine) inhibits spore germination of some plant pathogenic as well as saprophytic fungi . Corydalmine acts as an oral analgesic agent, exhibiting potent analgesic activity . Corydalmine alleviates Vincristine-induced neuropathic pain in mice by inhibiting an NF-κB-dependent CXCL1/CXCR2 signaling pathway .

HY-W028263

6-Hydroxyflavanone	Structural Classification Flavonoids Flavonones Source classification Muntingia calabura L. Plants Muntingiaceae	COX Opioid Receptor GABA Receptor Lipoxygenase
6-Hydroxyflavanone is a compound that can be isolated from the Muntingia calabura leaves. 6-Hydroxyflavanone targets cyclooxygenase-2 (COX-2), 5-lipoxygenase (5-LOX), and opioid and GABA-A receptors that has anti-inflammatory and anti-neuropathic pain potential. 6-Hydroxyflavanone can be used for the research of diabetes .

HY-N6967

Levomenol (-)-α-Bisabolol	Structural Classification other families Terpenoids Sesquiterpenes Source classification Plants	Apoptosis
Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .

HY-B1661

Hexamethonium chloride Hexone chloride	Cardiovascular Disease Classification of Application Fields Disease Research Fields	Biochemical Assay Reagents
Hexamethonium Chloride Dihydrate is a synthetic organic compound commonly used as a ganglion blocking agent, which means it blocks the transmission of nerve impulses between ganglion cells in the autonomic nervous system. Hexamethonium Chloride Dihydrate is used in various medical applications such as lowering blood pressure or inhibiting certain types of neuropathic pain. It works by inhibiting the release of acetylcholine, a neurotransmitter that plays a key role in regulating many bodily functions.

HY-N0405

Orientin 3 Publications Verification	Structural Classification Flavonoids other families Flavones Source classification Phenols Polyphenols Plants	TNF Receptor Interleukin Related
Orientin is a neuroprotective agentinhibits which has anti-inflammation, anti-oxidative, anti-tumor, and cardio protection properties. Orientin inhibits the levels of IL-6, IL-1β and TNF-α. Orientin increases IL-10 level. Orientin exhibits neuroprotective effect by inhibits TLR4 and NF-kappa B signaling pathway. Orientin can used in study neuropathic pain .

HY-N6967R

Levomenol (Standard)	Structural Classification other families Terpenoids Sesquiterpenes Source classification Plants	Apoptosis
Levomenol (Standard) is the analytical standard of Levomenol. This product is intended for research and analytical applications. Levomenol ((-)-α-Bisabolol), a monocyclic sesquiterpene alcohol, exerts antioxidant, anti-inflammatory, and anti-apoptotic activities. Levomenol also has neuroprotective effects and prevents neuronal damage and memory deficits through reduction of proinflammatory markers induced by permanent focal cerebral ischemia in mice. Levomenol attenuates nociceptive behaviour and central sensitisation in a rodent model of trigeminal neuropathic pain. Orally active .

HY-N0405R

Orientin (Standard)	Structural Classification Flavonoids other families Flavones Source classification Phenols Polyphenols Plants	TNF Receptor Interleukin Related
Orientin (Standard) is the analytical standard of Orientin. This product is intended for research and analytical applications. Orientin is a neuroprotective agentinhibits which has anti-inflammation, anti-oxidative, anti-tumor, and cardio protection properties. Orientin inhibits the levels of IL-6, IL-1β and TNF-α. Orientin increases IL-10 level. Orientin exhibits neuroprotective effect by inhibits TLR4 and NF-kappa B signaling pathway. Orientin can used in study neuropathic pain .

HY-Y0790

Cuminaldehyde p-Isopropylbenzaldehyde	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Rudbeckia laciniata L. Source classification Umbelliferae Plants Endogenous metabolite Disease Research Fields Cancer	Endogenous Metabolite Apoptosis DNA/RNA Synthesis α-synuclein Lipoxygenase Opioid Receptor Interleukin Related TNF Receptor
Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC₅₀= 0.00085 mg/mL), α-glucosidase (IC₅₀=0.5 mg/mL) and lipoxygenase (IC₅₀=1370 μM). Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .

HY-17387

(-)-Huperzine A 4 Publications Verification Huperzine A	Structural Classification Alkaloids Neurological Disease Classification of Application Fields Anti-aging Terpenoids Huperziaceae Sesquiterpenes Pyridine Alkaloids Huperzia serrata Plants Disease Research Fields	Cholinesterase (ChE) Apoptosis iGluR
(-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC₅₀ of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .

HY-Y0790R

Cuminaldehyde (Standard)	Structural Classification Ketones, Aldehydes, Acids Rudbeckia laciniata L. Source classification Umbelliferae Plants Endogenous metabolite	Endogenous Metabolite Apoptosis DNA/RNA Synthesis α-synuclein Lipoxygenase Opioid Receptor Interleukin Related TNF Receptor
Cuminaldehyde (Standard) is the analytical standard of Cuminaldehyde. This product is intended for research and analytical applications. Cuminaldehyde is the main component of Cuminum cyminum and has multiple biological activities, including anti-inflammatory, anti-cancer, anti-diabetic, anti-injury, anti-neuropathy and antibacterial effects. Cuminaldehyde is an inhibitor of aldose reductase (IC₅₀= 0.00085 mg/mL) and α-glucosidase (IC₅₀=0.5 mg/mL). Cuminaldehyde can modulate α-synuclein fibrils. Cuminaldehyde can induce apoptosis in colon adenocarcinoma cells by targeting topoisomerase I and II. In addition, Cuminaldehyde also exerts anti-inflammatory activity by inhibiting lipoxygenase. Cuminaldehyde has a strong inhibitory effect on the growth of Aspergillus flavus and the biosynthesis of aflatoxin B1 (AFB1). Cuminaldehyde can exert anti-injury and anti-neuropathy effects by participating in opioid receptors, L-arginine/NO/cGMP pathways and anti-inflammatory effects. Cuminaldehyde has potential application value in the research of neurodegenerative diseases, cancer, diabetes and neuropathic pain diseases .

Cat. No.	Product Name	Chemical Structure

HY-A0057S

Gabapentin-d4
Gabapentin-d₄ is the deuterium labeled Gabapentin. Gabapentin (Neurontin) is a pharmaceutical agent, specifically a GABA analog. It was originally developed to treat epilepsy, and currently is also used to relieve neuropathic pain.

HY-B0563S1

Ropivacaine-d7

Ropivacaine-d₇ is deuterium labeled Ropivacaine. Ropivacain is a potent sodium channel blocker. Ropivacain blocks impulse conduction via reversible inhibition of sodium ion influx in nerve fibrese[1][2]. Ropivacaine is also an inhibitor of K2P (two-pore domain potassium channel) TREK-1 with an IC50 of 402.7 μM in COS-7 cell's membrane[3]. Ropivacaine is used for the research of neuropathic pain management[1].

HY-B0563BS

Ropivacaine-d7 hydrochloride

Ropivacaine-d₇ hydrochloride is a deuterium labeled Ropivacaine (hydrochloride) (HY-B0563B) . Ropivacaine hydrochloride is a potent?sodium channel?blocker and blocks impulse conduction via reversible inhibition of?sodium ion influx?in nerve fibrese . Ropivacaine is also an inhibitor of K_2P (two-pore domain potassium channel) TREK-1 with an IC₅₀ of 402.7 μM in COS-7 cell's membrane . Ropivacaine is widely used for neuropathic pain?management in vivo .

HY-B0161ES

(±)-Duloxetine-d3 hydrochloride
(±)-Duloxetine-d₃ (hydrochloride) is deuterium labeled (±)-Duloxetine (hydrochloride). (±)-Duloxetine ((Rac)-Duloxetine) hydrochloride is the racemate of Duloxetine hydrochloride. Duloxetine hydrochloride, a serotonin-norepinephrine reuptake inhibitor, can be used for diabetic neuropathic pain and fibromyalgia as well as major depressive disorder research[1].

HY-A0057AS2

Gabapentin-d4 hydrochloride
Gabapentin-d4 hydrochloride is the deuterium labeled Gabapentin hydrochloride (HY-A0057A). Gabapentin hydrochloride is a potent, orally active P/Q type Ca ²⁺ channel blocker. Gabapentin hydrochloride inhibits neuronal Ca ²⁺ influx and reduction of neurotransmitter release. Gabapentin hydrochloride is a GABA analog that can be used to relieve neuropathic pain .

HY-17387S1

(-)-Huperzine A-d4 hydrochloride

(-)-Huperzine A-d₄ hydrochloride is deuterated labeled (-)-Huperzine A (HY-17387). (-)-Huperzine A (Huperzine A) is an alkaloid isolated from Huperzia serrata, with neuroprotective activity. (-)-Huperzine A is a potent, highly specific, reversible and blood-brain barrier penetrant inhibitor of acetylcholinesterase (AChE), with an IC₅₀ of 82 nM. (-)-Huperzine A also is non-competitive antagonist of N-methyl-D-aspartate glutamate (NMDA) receptor. (-)-Huperzine A is developed for the research of neurodegenerative diseases, including Alzheimer’s disease .

Cat. No.	Product Name		Classification

HY-151391

LPA5 antagonist 1		Alkynes
LPA5 antagonist 1 (Compound 66) is a potent and selective lysophosphatidic acid receptor 5 (LPA5) antagonist (IC₅₀=32 nM). LPA5 antagonist 1 shows high brain permeability and anti-nociceptive activity. LPA5 antagonist 1 can be used in inflammatory and neuropathic pain research . LPA5 antagonist 1 is a click chemistry reagent, it contains an Alkyne group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing Azide groups.

HY-159113

PCC0105003		Azide
PCC0105003 is a potent MARK inhibitor. PCC0105003 can be used in the study of neuropathic pain .

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent:

neuropathic

Inhibitors & Agonists

Biochemical Assay Reagents

Peptides

NaturalProducts

Isotope-Labeled Compounds

Click Chemistry

Natural
Products