Search Result

Results for "

MET

" in MedChemExpress (MCE) Product Catalog:

By Targets:	c-Met/HGFR (158) 5-HT Receptor (4) ADC Cytotoxin (1) Adenylate Cyclase (3) Adrenergic Receptor (5) Akt (11) Amino Acid Decarboxylase (1) Amino Acid Derivatives (20) Aminopeptidase (1) AMPK (6) Amylases (1) Amylin Receptor (1) Amyloid-β (66) Anaplastic lymphoma kinase (ALK) (13) Androgen Receptor (6) Angiotensin Receptor (7) Angiotensin-converting Enzyme (ACE) (1) Annexin A (2) Antibiotic (15) Antibody-Drug Conjugates (ADCs) (2) Antifolate (1) Apelin Receptor (APJ) (19) Apoptosis (87) Aquaporin (4) Arenavirus (2) Arrestin (3) Autophagy (21) Bacterial (90) Bcl-2 Family (15) Beta-secretase (1) Biochemical Assay Reagents (26) Bombesin Receptor (7) Bradykinin Receptor (1) Btk (2) c-Fms (1) c-Kit (10) Calcium Channel (21) Calmodulin (5) CaMK (3) Cannabinoid Receptor (1) Casein Kinase (4) Caspase (7) Cathepsin (1) CCR (3) CD28 (1) CD74 (1) CDK (1) CGRP Receptor (8) Checkpoint Kinase (Chk) (3) Chloride Channel (3) Cholecystokinin Receptor (18) Cholinesterase (ChE) (3) CMV (3) Complement System (1) COX (2) CRFR (14) CXCR (3) Cytochrome P450 (2) Dengue Virus (2) Deubiquitinase (1) Dipeptidyl Peptidase (2) Discoidin Domain Receptor (2) DNA/RNA Synthesis (5) Dopamine Receptor (2) Drug Derivative (6) Drug Metabolite (1) Drug-Linker Conjugates for ADC (2) E1/E2/E3 Enzyme (1) E3 Ligase Ligand-Linker Conjugates (1) EBV (5) EGFR (12) Elastase (3) Endogenous Metabolite (22) Endothelin Receptor (13) Epigenetic Reader Domain (1) ERK (8) Estrogen Receptor/ERR (1) FAK (2) Ferroptosis (1) FGFR (5) FLT3 (13) Fluorescent Dye (13) Formyl Peptide Receptor (FPR) (13) Free Fatty Acid Receptor (1) Fungal (19) FXR (1) GABA Receptor (1) Galectin (1) GCGR (29) GHSR (6) GLP Receptor (10) Glucocorticoid Receptor (1) GLUT (1) Glutaminase (2) GnRH Receptor (2) HCV (3) HCV Protease (2) HDAC (3) Hedgehog (1) Hexokinase (1) HIF/HIF Prolyl-Hydroxylase (3) Histamine Receptor (1) Histone Demethylase (1) Histone Methyltransferase (1) HIV (13) HPV (1) HSP (1) HSV (1) IGF-1R (2) iGluR (4) IKK (1) Influenza Virus (6) Insulin Receptor (23) Integrin (4) Interleukin Related (8) IRAK (1) Isotope-Labeled Compounds (18) JAK (1) JNK (4) Kallikrein (2) LAG-3 (2) LDLR (2) Ligands for Target Protein for PROTAC (1) LIM Kinase (LIMK) (1) Lipoxygenase (1) mAChR (4) Mas-related G-protein-coupled Receptor (MRGPR) (1) MCHR1 (GPR24) (7) MDM-2/p53 (10) MEK (4) Melanocortin Receptor (25) MetAP (1) METTL3 (2) MHC (1) Microtubule/Tubulin (2) Mitochondrial Metabolism (5) MMP (6) Motilin Receptor (2) mTOR (4) MyD88 (2) nAChR (8) Natriuretic Peptide Receptor (NPR) (7) Neprilysin (2) Neurokinin Receptor (41) Neuropeptide B/W Receptor (3) Neuropeptide FF Receptor (4) Neuropeptide S Receptor (2) Neuropeptide Y Receptor (25) NF-κB (9) NO Synthase (1) Nuclear Factor of activated T Cells (NFAT) (2) Opioid Receptor (30) Orexin Receptor (OX Receptor) (7) P-glycoprotein (2) p38 MAPK (1) PACAP Receptor (14) Parasite (2) PARP (2) PD-1/PD-L1 (3) PDGFR (4) PDK-1 (1) Peptide-Drug Conjugates (PDCs) (1) PERK (3) Phosphatase (5) PI3K (10) PKC (3) PKG (4) Platelet-activating Factor Receptor (PAFR) (1) Polo-like Kinase (PLK) (1) Potassium Channel (45) Prion Protein (1) Prostaglandin Receptor (2) PROTAC Linkers (1) PROTACs (6) Protease Activated Receptor (PAR) (1) Proteasome (4) Proton Pump (1) PTHR (2) RABV (5) RAD51 (2) Radionuclide-Drug Conjugates (RDCs) (2) Raf (6) Ras (6) Reactive Oxygen Species (11) Renin (1) RET (2) RIP kinase (1) ROS Kinase (10) RSV (1) RXFP Receptor (1) Salt-inducible Kinase (SIK) (1) SARS-CoV (3) Ser/Thr Protease (1) Sex Pheromone (2) Small Interfering RNA (siRNA) (6) SOD (1) Sodium Channel (26) Somatostatin Receptor (4) Src (1) STAT (2) TAM Receptor (21) Tau Protein (4) TGF-beta/Smad (2) TGF-β Receptor (1) Thrombopoietin Receptor (1) Thyroid Hormone Receptor (13) TMV (1) TNF Receptor (5) Toll-like Receptor (TLR) (5) Topoisomerase (1) Transferrin Receptor (2) Transmembrane Glycoprotein (3) Trk Receptor (5) TRP Channel (5) Tyrosinase (4) Vasopressin Receptor (2) VEGFR (30) VSV (1) Wnt (6) YAP (1)
By Research Areas:	Cancer (359) Cardiovascular Disease (119) Endocrinology (98) Infection (134) Inflammation/Immunology (171) Metabolic Disease (184) Neurological Disease (339)
Click Chemistry:	Alkynes (3)
Oligonucleotides:	Rat Pre-designed siRNA Sets (1) Mouse Pre-designed siRNA Sets (1) Human Pre-designed siRNA Sets (1) siRNAs (3)

1227

Inhibitors & Agonists

Screening Libraries

Fluorescent Dye

1192

Peptides

Inhibitory Antibodies

Natural
Products

Recombinant Proteins

Isotope-Labeled Compounds

Antibodies

Click Chemistry

Oligonucleotides

Targets Recommended: c-Met/HGFR

Cat. No.	Product Name	Target	Research Areas	Chemical Structure

HY-18309

MET kinase-IN-4	c-Met/HGFR VEGFR	Cancer
MET kinase-IN-4 is an orally active Met kinase inhibitor. MET kinase-IN-4 has potent Met kinase inhibitory activity with an IC₅₀ value of 1.9 nM. MET kinase-IN-4 can be used for the research of cancer .

HY-P4191A

Met-RANTES (human) (acetate)	CCR	Inflammation/Immunology
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-P4270

Met-Arg-Phe-Ala	Neprilysin	Neurological Disease
Met-Arg-Phe-Ala is a peptide. Met-Arg-Phe-Ala also is a potent competitive inhibitor for enkephalin-generating endopeptidase (EGE). Met-Arg-Phe-Ala can be used for the research of neurological disease .

HY-P4344

Met-Gly-Pro-AMC	MetAP	Others
Met-Gly-Pro-AMC is a fluorescent peptide substrate of MetAP2 .

HY-162773

MET-IN-1	c-Met/HGFR	Cancer
MET-IN-1 (Compound 13) is an orally active *MET* inhibitor. MET-IN-1 has antitumor activity .

HY-146884

MET kinase-IN-3	c-Met/HGFR VEGFR	Cancer
MET kinase-IN-3 (compound 8) is an orally active and potent *MET* inhibitor, with an IC₅₀ of 9.8 nM. MET kinase-IN-3 shows good and broad-spectrum antiproliferative activity against cancer cell lines .

HY-P6440

Met-12	Apoptosis Caspase	Others
Met-12 is a small peptide inhibitor of the Fas receptor. Met-12 can inhibit Fas receptor-mediated photoreceptor cell apoptosis, reduce Caspase activation. Met-12 can be used in the research of photoreceptor .

HY-P4191

Met-RANTES (human) MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN	CCR	Inflammation/Immunology
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC₅₀ of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .

HY-164884

MetsiRNA-3	Small Interfering RNA (siRNA) c-Met/HGFR	Others
MetsiRNA-3 is a Small Interfering RNA (siRNA) targeting *Met* for knocking down the *Met* gene.

HY-P4196

Met-Enkephalin-Arg-Phe	Opioid Receptor	Neurological Disease
Met-Enkephalin-Arg-Phe is a naturally occurring heptapeptide with analgesic activity .

HY-139132

Met-F-AEA	Apoptosis	Cancer
Met-F-AEA is a metabolically stable anandamine analogue. Met-F-AEA inhibits cell growth by activating apoptosis. Met-F-AEA has antitumor activity .

HY-129865

MET oxalate	Drug Derivative	Neurological Disease
MET oxalate is s a tryptamine.

HY-149510

MET/PDGFRA-IN-1	c-Met/HGFR Apoptosis PDGFR	Cancer
MET/PDGFRA-IN-1 (compound 8c) is a *MET* and PDGFRA protein inhibitor (IC₅₀: 36 μM for MET). MET/PDGFRA-IN-1 inhibits MET phosphorylation and induces cell apoptosis. MET/PDGFRA-IN-1 inhibits proliferation of MET-positive cells (IC₅₀s: 15.3, 19.0, 22.0, 25.6, 21.0, 31.5 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .

HY-131065

MET kinase-IN-2	c-Met/HGFR	Cancer
MET kinase-IN-2 is a potent, selective, orally bioavailable MET kinase inhibitor with an IC₅₀ of 7.4 nM. MET kinase-IN-2 has antitumor activity .

HY-P0073

*Tyr-Gly-Gly-Phe-Met-OH* 2 Publications Verification MET-Enkephalin; METhionine enkephalin; METenkefalin	Opioid Receptor	Neurological Disease Cancer
Tyr-Gly-Gly-Phe-Met-OH regulates human immune function and inhibits tumor growth via binding to the opioid receptor.

HY-149511

MET/PDGFRA-IN-2	c-Met/HGFR Apoptosis PDGFR	Cancer
MET/PDGFRA-IN-2 (compound 8h) is a *MET* and PDGFRA protein inhibitor. MET/PDGFRA-IN-2 induces cell apoptosis. MET/PDGFRA-IN-2 inhibits proliferation of MET-positive cells (IC₅₀s: 9.7, 6.1, 12.0, 11.5, 8.6, 34.4 μM for AsPc-1, EBC-1, MKN-45, Mia-Paca-2, HT-29, K562 cells respectively) .

HY-164883

MetsiRNA-2	Small Interfering RNA (siRNA)	Others
MetsiRNA-2 is a small interfering RNA that targets *Met* messenger RNA.

HY-164882

MetsiRNA-1	Small Interfering RNA (siRNA)	Others
MetsiRNA-1 is a small interfering RNA that targets *Met* messenger RNA.

HY-RS08346

Met Mouse Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Met Mouse Pre-designed siRNA Set A contains three designed siRNAs for Met gene (Mouse), as well as a negative control, a positive control, and a FAM-labeled negative control.

Met Mouse Pre-designed siRNA Set A Met Mouse Pre-designed siRNA Set A

HY-RS08345

MET Human Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
MET Human Pre-designed siRNA Set A contains three designed siRNAs for MET gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.

MET Human Pre-designed siRNA Set A MET Human Pre-designed siRNA Set A

HY-RS08347

Met Rat Pre-designed siRNA Set A	Small Interfering RNA (siRNA)	Others
Met Rat Pre-designed siRNA Set A contains three designed siRNAs for Met gene (Rat), as well as a negative control, a positive control, and a FAM-labeled negative control.

Met Rat Pre-designed siRNA Set A Met Rat Pre-designed siRNA Set A

HY-B1836

Meldonium 3 Publications Verification MET-88; Quaterin	Mitochondrial Metabolism	Cardiovascular Disease Metabolic Disease
Meldonium (MET-88) functions as a cardioprotective agent by cpmpetetively inhibiting γ-butyrobetaine hydroxylase (BBOX) and carnitine/organic cation transporter type 2 (OCTN2). Mildronate (Meldonium) exhibits IC₅₀ values of 34-62 μM for human recombinant BBOX and an EC₅₀ of 21 μM for human OCTN2. Meldonium is a fatty acid oxidation inhibitor .

HY-159627A

Met-AMS TEA	Bacterial	Infection
Met-AMS TEA (compound 50), a sulfamate analogue of methionyl adenylate, is a potent Escherichia coli methionyl-tRNA synthetase (MetRS) inhibitor (IC₅₀ of 7 nM) .

HY-P3781

*(Met(O)35)-Amyloid β-Protein (1-42)*	Amyloid-β	Neurological Disease
(Met(O)35)-Amyloid β-Protein (1-42) is the oxidation form of Met35 in Aβ42. (Met(O)35)-Amyloid β-Protein (1-42) can yield an oligomer size distribution characteristic of Aβ40. (Met(O)35)-Amyloid β-Protein (1-42) can be used in the research of Alzheimer’s disease (AD) .

HY-147296

Omesdafexor MET642	FXR	Inflammation/Immunology Cancer
Omesdafexor (MET642) is an oral FXR agonist. Omesdafexor can improve colitis induced by adoptive T cell transfer，promote intestinal antimicrobial function, barrier function and inhibit inflammation .

HY-P3750

Methionyl-Lysyl-Bradykinin MET-Lys-Bradykinin	Bradykinin Receptor	Cardiovascular Disease Endocrinology
Methionyl-Lysyl-Bradykinin (Met-Lys-Bradykinin), a Bradykinin (HY-P0206) analogue, is a kinin .

HY-B1836A

Meldonium dihydrate 3 Publications Verification MET-88 dihydrate; Quaterin dihydrate	Mitochondrial Metabolism	Cardiovascular Disease Neurological Disease Metabolic Disease
Meldonium (MET-88) dihydrate functions as a cardioprotective agent by cpmpetetively inhibiting γ-butyrobetaine hydroxylase (BBOX) and carnitine/organic cation transporter type 2 (OCTN2). Mildronate dihydrate exhibits IC₅₀ values of 34-62 μM for human recombinant BBOX and an EC₅₀ of 21 μM for human OCTN2. Meldonium dihydrate is a fatty acid oxidation inhibitor .

HY-P4672

*(Met(O)27)-Glucagon (1-29) (human, rat, porcine)*	GCGR	Metabolic Disease
(Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .

HY-P3782

*(Met(O2)35)-Amyloid β-Protein (1-42)*	Amyloid-β	Others
(Met(O2)35)-Amyloid β-Protein (1-42) is a peptide .

HY-W012159

Methionylserine H-MET-SER-OH	Angiotensin-converting Enzyme (ACE)	Cardiovascular Disease
Methionylserine (H-MET-SER-OH) is a methionine- and serine-containing dipeptide. Methionylserine binds to and translocation via intestinal di/tri-peptide transporter 1 (hPEPT1) with a K_m value of 0.2 mM. Methionylserine inhibits ACE enzyme activity. Methionylserine can be used in the research of hypension .

HY-18711A

SCR-1481B1 METatinib anhydrous; c-MET inhibitor 2	c-Met/HGFR VEGFR	Cancer
SCR-1481B1 (Metatinib anhydrous) is a potent compound that has activity against cancers dependent upon Met activation and also has activity against cancers as a VEGFR inhibitor.

HY-P99250

Onartuzumab 1 Publications Verification METMAb	c-Met/HGFR	Cancer
Onartuzumab (MetMAb) is a unique, humanized and affinity-matured monovalent (one-armed) monoclonal antibody against the *MET* receptor. Onartuzumab potently inhibits HGF binding and receptor phosphorylation and signaling. Onartuzumab has antibody-like pharmacokinetics and antitumor activity .

HY-18711

SCR-1481B1 free base METatinib free base; c-MET inhibitor 2 free base	c-Met/HGFR VEGFR	Cancer
SCR-1481B1 free base, also known as Metatinib free base, is a small molecule receptor kinase inhibitor that targets both c-MET and vascular endothelial growth factor receptor 2 (VEGFR2) .

HY-135763

Metabolex-36 MET-36	Free Fatty Acid Receptor	Others Endocrinology
Metabolex-36 is a FFA4 agonist with a pEC₅₀ value of 5.9 and a pEC₅₀ value of less than 4.0 for FFA1.

HY-W419331

Methionyl-methionine DL-METhionyl-DL-METhionine	JAK mTOR	Cancer
Methionylmethionine (Met-Met) significantly promotes α-s1 casein (α_S1-CN) expression in the mammary explants by enhancing intracellular substrate availability and activating JAK2-STAT5 and mTOR-mediated signaling pathways .

HY-W175543

Methoxyurea	NO Synthase	Cardiovascular Disease
Methoxyurea (Compound 3) is a potential regulator of nitric oxide (NO) donors that acts on hemoglobins such as oxy-hemoglobin (OxyHb) and met-hemoglobin (MetHb). Methoxyurea is promising for research of sickle cell disease (SCD) .

HY-B1836S

Meldonium-d3 MET-88-d₃; Quaterin-d₃	Isotope-Labeled Compounds Mitochondrial Metabolism	Cardiovascular Disease Metabolic Disease
Meldonium-d3 is the deuterated form of Meldonium. Meldonium is a cardiovascular protective agent that competitively inhibits BBOX1 and OCTN2. The IC₅₀ value of Mildronate against human recombinant BBOX is 34-62 μM, and the EC₅₀ value against human OCTN2 is 21 μM. Meldonium is a fatty acid oxidation inhibitor .

HY-W012817

Methylhydroquinone	COX	Inflammation/Immunology
Methylhydroquinone is an orally active COX inhibitor with IC₅₀s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions .

HY-W012817R

Methylhydroquinone (Standard)	COX	Others
Methylhydroquinone (Standard) is the analytical standard of Methylhydroquinone. This product is intended for research and analytical applications. Methylhydroquinone is an orally active COX inhibitor with IC50s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions[1][2].

HY-P1087

Adrenorphin METorphamide	Opioid Receptor	Cancer
Adrenorphin is a opioid octapeptide, acting as a potent agonist of μ-opioid receptor, with K_i of 12 nM.

HY-P4356

D-Met-Met	Amino Acid Derivatives	Others
D-Met-Met is an orally active methionine dipeptide and has potential applications in food supplements .

HY-P4439

*H-Met-Val-OH*	Amino Acid Derivatives	Neurological Disease
H-Met-Val-OH is a dipeptide containing free N-terminal methionine. H-Met-Val-OH exhibits activity against cDNA expressing Flavin-containing monooxygenase (FMO) 1 and FMO3. H-Met-Val-OH has potential applications in the growth of neuritis .

HY-P4553

*H-Met-Pro-OH*	Amino Acid Derivatives	Others
H-Met-Pro-OH is a dipeptide containing methionine and proline. H-Met-Pro-OH is a substrate for aminopeptidase P (APP) and skin fibroblast prolidase .

HY-P4559

*H-Pro-Met-OH*	Dipeptidyl Peptidase	Others
H-Pro-Met-OH is a dipeptide containing proline and methionine, which can serve as a substrate for prolinase. H-Pro-Met-OH can also be used for the synthesis of polypeptides .

HY-150013

*H-Met-Met-OH* L-METhionyl-L-METhionine	Others	Others
H-Met-Met-OH (L-Methionyl-L-methionine) is a dipeptide composed of two methionine residues .

HY-P4393

*H-Leu-Trp-Met-Arg-OH*	Aminopeptidase	Others
H-Leu-Trp-Met-Arg-OH is a tetrapeptide. H-Leu-Trp-Met-Arg-OH can be used as a substrate for aminopeptidase-mediated hydrolysis studies .

HY-P4437

*H-Met-Phe-OH*	Amino Acid Derivatives	Others
H-Met-Phe-OH is a methionine derivative containing methionine and phenylalanine .

HY-P1937

*Cyclo(-Met-Pro)*	Influenza Virus	Infection
Cyclo(-Met-Pro) is a cyclic dipeptide consisting of the amino acids methionine and proline. Cyclo(-Met-Pro) exhibits weak inhibitory activity against the influenza A virus (H3N2) (5 mM, 2.1% inhibition), while cis-cyclo(Leu-Pro) and cis-cyclo(Phe-Pro) shows significant antiviral activity .

HY-148279

*c-Met-IN-15*	c-Met/HGFR	Cancer
c-Met-IN-15 (compound S3) is a *c-Met* kinase** inhibitor. c-Met-IN-15 inhibits c-Met kinase activity of 21.1% at the concentration of 10 μM .

HY-P1467

*[Met5]-Enkephalin, amide* 5-METhionine-enkephalin amide	Opioid Receptor	Neurological Disease
[Met5]-Enkephalin, amide is an agonist for δ opioid receptors as well as putative ζ ζ opioid receptors.

Cat. No.	Product Name	Category	Target	Chemical Structure

HY-W012817

Methylhydroquinone	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Other Diseases Disease Research Fields	COX
Methylhydroquinone is an orally active COX inhibitor with IC₅₀s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions .

HY-W016647

*For-Met-OH* N-FormylMEThionine	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
For-Met-OH is an endogenous metabolite.

HY-P1904

*Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa*	Natural Products Animals Source classification	Others
Phe-Met-Arg-Phe Like Peptide, Snail Helix aspersa is a FMRF-like peptide from visceral and somatic muscles of the snail Helix aspersa. FMRF (Phe-Met-Arg-Phe) is a neuropeptide peptide consisting of 4 amino acid residues .

HY-N6797

Meleagrin	Infection Alkaloids Microorganisms Classification of Application Fields Source classification Disease Research Fields Indole Alkaloids	Bacterial c-Met/HGFR Antibiotic
Meleagrin is a roquefortine C-derived alkaloid produced by fungi of the genus Penicillium and has antimicrobial and anti-proliferative activities. Meleagrin is a class of FabI inhibitor. Meleagrin is a lead *c-Met* inhibitory entity useful for the control of c-Met-dependent metastatic and invasive breast malignancies .

HY-W010104

L-Methionine sulfoxide H-MET(O)-OH	Structural Classification Classification of Application Fields Ketones, Aldehydes, Acids Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite
L-Methionine sulfoxide is an orally active oxidation product of Methionine (HY-N0326). L-Methionine sulfoxide can be partially converted into Methionine in the body and participate in the synthesis of glutathione in the liver. L-Methionine sulfoxide provides the body with sulfur activity and can participate in the synthesis of proteins and sulfur-containing compounds .

HY-W015309

Decanoic acid 2 Publications Verification	Structural Classification Microorganisms Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Endogenous metabolite Disease Research Fields Biological Pesticide Research Agricultural Research	iGluR Tyrosinase c-Met/HGFR Glutaminase Endogenous Metabolite
Decanoic acid is a key component of the medium-chain triglyceride (MCT) found in coconut oil. Decanoic acid is a brain-penetrant and non-competitive inhibitor of AMPA receptor showing antiseizure activity in rats. Decanoic acid reduces tyrosinase activity and inhibits melanosome maturation. Decanoic acid suppresses the phosphorylation of *c-Met* and induced apoptosis in hepatocellular carcinoma (HCC) cells by inhibiting the expression of various oncogenic proteins, which is promising for research in the field of mTORC1 signaling, HCC and epilepsy .

HY-P4196

Met-Enkephalin-Arg-Phe	Structural Classification Monophenols Source classification Phenols Endogenous metabolite	Opioid Receptor
Met-Enkephalin-Arg-Phe is a naturally occurring heptapeptide with analgesic activity .

HY-W012817R

Methylhydroquinone (Standard)	Structural Classification Natural Products Microorganisms Source classification	COX
Methylhydroquinone (Standard) is the analytical standard of Methylhydroquinone. This product is intended for research and analytical applications. Methylhydroquinone is an orally active COX inhibitor with IC50s of 480.7 μM and 52.2 μM for ovine COX-1 and human recombinant COX-2, respectively. Methylhydroquinone has potential DNA damaging effects: 1) inhibiting COX-1 to reduce prostaglandin synthesis and exert anti-inflammatory activity; 2) inducing DNA single-strand breaks. Methylhydroquinone exerts its effects by competitively binding to the active sites of COX-1 (such as Tyr385, Met522) and non-covalent interactions[1][2].

HY-W016647R

*For-Met-OH (Standard)*	Structural Classification Ketones, Aldehydes, Acids Source classification Endogenous metabolite	Endogenous Metabolite
For-Met-OH (Standard) is the analytical standard of For-Met-OH. This product is intended for research and analytical applications. For-Met-OH is an endogenous metabolite.

HY-N10219

Dihydroaltenuene B	Infection Monophenols Microorganisms Classification of Application Fields Source classification Phenols Disease Research Fields	Tyrosinase Fungal
Dihydroaltenuene B is a potent mushroom tyrosinase inhibitor with an IC₅₀ of 38.33 µM. Dihydroaltenuene B shows the hydrogen bonding interactions between the 3-OH and 4’-OH and the His244, Met280 and Gly281 residues of tyrosinase .

HY-W015309R

Decanoic acid (Standard)	Structural Classification Microorganisms Ketones, Aldehydes, Acids Source classification Endogenous metabolite	iGluR Tyrosinase c-Met/HGFR Glutaminase
Decanoic acid (Standard) is the analytical standard of Decanoic acid. This product is intended for research and analytical applications. Decanoic acid is a key component of the medium-chain triglyceride (MCT) found in coconut oil. Decanoic acid is a brain-penetrant and non-competitive inhibitor of AMPA receptor showing antiseizure activity in rats. Decanoic acid reduces tyrosinase activity and inhibits melanosome maturation. Decanoic acid suppresses the phosphorylation of c-Met and induced apoptosis in hepatocellular carcinoma (HCC) cells by inhibiting the expression of various oncogenic proteins, which is promising for research in the field of mTORC1 signaling, HCC and epilepsy .

HY-P0173B

Chlorotoxin TFA 1 Publications Verification	Structural Classification Natural Products Classification of Application Fields Animals Source classification Disease Research Fields Cancer	Chloride Channel
Chlorotoxin TFA is a peptide isolated from the venom of the scorpion Leiurus quinquestriatus, acts as a chloride channel blocker . Anti-cancer activity .

HY-P0173A

Chlorotoxin	Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields Cancer	Chloride Channel
Chlorotoxin is a 36 amino-acid peptide from the venom of the Israeli scorpion Leiurus quinquestriatus with anticancer activity. Chlorotoxin is a chloride channel blocker.

HY-P0268

Myomodulin	Structural Classification Natural Products Animals Source classification	Calcium Channel Potassium Channel Sodium Channel
Myomodulin is a neuropeptide present in molluscs, insects, and gastropods.

HY-P5664

Maximin S4	Structural Classification Animals Ketones, Aldehydes, Acids Source classification	Bacterial
Maximin S4 is an antimicrobial peptide derived from toad Bombina maxima. Maximin S4 has antibacterial activity against mycoplasma .

HY-P0263

Dermaseptin	Infection Structural Classification Natural Products Classification of Application Fields Animals Source classification Disease Research Fields	Bacterial Fungal Antibiotic
Dermaseptin, a peptide isolated from frog skin, exhibits potent antimicrobial activity against bacteria, fungi, and protozoa at micromolar concentration .

HY-P5702

EP3	Structural Classification Animals Ketones, Aldehydes, Acids Source classification	Bacterial Apoptosis Fungal
EP3 is an antimicrobial peptide. EP3 has antibacterial and antifungal activities. EP3 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 12.85 μg/mL. EP3 also shows antitumor activity against cancer cells, and induces cell apoptosis .

HY-P5701

EP2	Structural Classification Animals Ketones, Aldehydes, Acids Source classification	Bacterial Fungal
EP2 is an antimicrobial peptide. EP2 has antibacterial and antifungal activities. EP2 inhibits E. gallinarum, P. pyocyanea, A. baumanii, K. terrigena with a MIC value of 11.4 μg/mL .

HY-P0241

Neuromedin B 1 Publications Verification	Structural Classification Natural Products Animals Source classification Endogenous metabolite	Endogenous Metabolite
Neuromedin B (NMB) is a member of Bombesin (BN)-like peptide family in mammals.

HY-A0190

Ceruletide Maximum Cited Publications 97 Publications Verification Caerulein; Cerulein; FI-6934	Cardiovascular Disease Alkaloids Structural Classification Animals Classification of Application Fields Source classification Disease Research Fields Endocrinology Indole Alkaloids	Cholecystokinin Receptor
Ceruletide is a decapeptide and a potent cholecystokinin receptor agonist. Ceruletide is a safe and effective cholecystokinetic agent with a direct spasmogenic effect on the gallbladder muscle and bile ducts .

HY-P0255

Physalaemin	Structural Classification Animals Neurological Disease Classification of Application Fields Ketones, Aldehydes, Acids Source classification Phenols Disease Research Fields Endocrinology	Neurokinin Receptor
Physalaemin, a non-mammalian tachykinin, binds selectively to neurokinin-1 (NK1) receptor with high affinity.

HY-P0201

Substance P 15+ Cited Publications Neurokinin P	Structural Classification Natural Products Neurological Disease Classification of Application Fields Source classification Endogenous metabolite Disease Research Fields Endocrinology	Neurokinin Receptor Endogenous Metabolite
Substance P (Neurokinin P) is a neuropeptide, acting as a neurotransmitter and as a neuromodulator in the CNS. The endogenous receptor for substance P is neurokinin 1 receptor (NK1-receptor, NK1R).

HY-P1482

α-Factor Mating Pheromone, yeast 1 Publications Verification Mating Factor α	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Disease Research Fields Endocrinology	Sex Pheromone
α-Factor Mating Pheromone, yeast is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor.

HY-P0250

Kassinin	Structural Classification Natural Products Animals Neurological Disease Classification of Application Fields Source classification Disease Research Fields Endocrinology	Neurokinin Receptor
Kassinin is a peptide derived from the Kassina frog. It belongs to tachykinin family of neuropeptides. It is secreted as a defense response, and is involved in neuropeptide signalling.

HY-P1482A

α-Factor Mating Pheromone, yeast TFA 1 Publications Verification Mating Factor α TFA	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Disease Research Fields Cancer	Sex Pheromone
α-Factor Mating Pheromone, yeast (TFA) is a tridecapeptide secreted by S. cerevisiae α cells via Ste2p receptor .

HY-P0195

Bombesin 1 Publications Verification	Structural Classification Natural Products Animals Source classification	Bombesin Receptor
Bombesin, a tetradecapeptide, plays an important role in the release of gastrin and the activation of G-protein receptors .

HY-P0279

Systemin	Structural Classification Natural Products other families Classification of Application Fields Source classification Other Diseases Solanum lycopersicum L. Solanaceae Plants Disease Research Fields	Endogenous Metabolite
Systemin, an 18-amino acid polypeptide, has been isolated from tomato leaves that is a powerful inducer of over 15 defensive genes.

HY-P0269

Magainin 1 Magainin I	Infection Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields	Bacterial Fungal Antibiotic
Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .

HY-P0269A

Magainin 1 TFA Magainin I TFA	Infection Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields	Bacterial Fungal Antibiotic
Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .

HY-P0270

Magainin 2 Magainin II	Infection Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields	Bacterial Antibiotic Fungal
Magainin 2 (Magainin II) is an antimicrobial peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa . Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes .

HY-P2358

PSMα3	Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Inflammation/Immunology Disease Research Fields	Toll-like Receptor (TLR)
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .

HY-P0259

Xenin	Structural Classification Natural Products Source classification Endogenous metabolite	Endogenous Metabolite
Xenin is a 25-amino acid peptide initially isolated from human gastric mucosa. Xenin is a gut hormone that can reduce food intake.

HY-P0285

Rabies Virus Glycoprotein 1 Publications Verification	Infection Structural Classification Natural Products Microorganisms Classification of Application Fields Source classification Disease Research Fields	RABV
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.

HY-P1866A

β-Endorphin, equine TFA	Structural Classification Natural Products Source classification Endogenous metabolite	Opioid Receptor
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .

HY-P1866

β-Endorphin, equine	Natural Products Source classification Endogenous metabolite	Opioid Receptor
β-Endorphin, equine is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors . Analgesic properties .

HY-P1841

Glucagon-Like Peptide (GLP) II, human	Natural Products Classification of Application Fields Source classification Metabolic Disease Endogenous metabolite Disease Research Fields	Endogenous Metabolite Apoptosis
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .

HY-P1543

Exendin-3	Structural Classification Natural Products Animals Source classification	GLP Receptor Amylases GCGR
Exendin-3 is a biologically active peptides isolated from venoms of the Gila monster lizards, Heloderma horridurn.

HY-P0190

Iberiotoxin 1 Publications Verification	Cardiovascular Disease Structural Classification Natural Products Animals Classification of Application Fields Source classification Disease Research Fields	Potassium Channel
Iberiotoxin is a toxin isolated from Buthus tamulus scorpion venom. Iberiotoxin is a selective high conductance high conductance Ca ²⁺-activated K ⁺ channel inhibitor with a K_d of ~1 nM. Iberiotoxin does not block other types of voltage-dependent ion channels .

HY-P1280

Margatoxin	Natural Products Animals Neurological Disease Source classification Disease Research Fields	Potassium Channel
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (K_d=11.7 pM). Margatoxin inhibits the Kv1.2 (K_d=6.4 pM) and Kv1.1 (K_d=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .

HY-P1189

Echistatin	Structural Classification Natural Products Animals Classification of Application Fields Source classification Inflammation/Immunology Disease Research Fields	Integrin
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of α_IIbβ₃, α_vβ₃ and α₅β₁ .

HY-P1189A

Echistatin TFA	Structural Classification Natural Products Animals Classification of Application Fields Source classification Metabolic Disease Inflammation/Immunology Disease Research Fields	Integrin
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of α_IIbβ₃, α_vβ₃ and α₅β₁ .

HY-P0017

Aprotinin 15+ Cited Publications	Cardiovascular Disease Natural Products Animals Source classification Disease Research Fields	Influenza Virus Ser/Thr Protease
Aprotinin is a bovine pancreatic trypsin inhibitor (BPTI) inhibitor which inhibits trypsin and chymotrypsin with K_is of 0.06 pM and 9 nM, respectively.

Cat. No.	Product Name	Chemical Structure

HY-W008371S2

*Fmoc-Met-OH-d3*
Fmoc-Met-OH-d₃ is the deuterium labeled Fmoc-Met-OH.

HY-50878S

Crizotinib-d5

Crizotinib-d₅ is the deuterium labeled Crizotinib. Crizotinib (PF-02341066) is an orally bioavailable, ATP-competitive ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. Crizotinib is also a ROS1 inhibitor. Crizotinib has effective tumor growth inhibition .

HY-B1836S

Meldonium-d3
Meldonium-d3 is the deuterated form of Meldonium. Meldonium is a cardiovascular protective agent that competitively inhibits BBOX1 and OCTN2. The IC₅₀ value of Mildronate against human recombinant BBOX is 34-62 μM, and the EC₅₀ value against human OCTN2 is 21 μM. Meldonium is a fatty acid oxidation inhibitor .

HY-W008371S

*Fmoc-Met-OH-15N*
Fmoc-Met-OH- ¹⁵N is the ¹⁵N labeled Fmoc-Met-OH[1].

HY-W008371S1

*Fmoc-Met-OH-13C5,15N*
Fmoc-Met-OH- ¹³C₅, ¹⁵N is a ¹⁵N-labeled and ¹³C-labled Fmoc-L-Val-OH[1].

HY-50878S2

Crizotinib-d9

Crizotinib-d₉ (PF-02341066-d₉) is deuterium labeled Crizotinib. Crizotinib (PF-02341066) is an orally bioavailable, ATP-competitive ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. Crizotinib is also a ROS1 inhibitor. Crizotinib has effective tumor growth inhibition .

HY-50878S1

Crizotinib-d8

Crizotinib-d₈ (PF-02341066-d₈) is deuterium labeled Crizotinib. Crizotinib (PF-02341066) is an orally bioavailable, ATP-competitive ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. Crizotinib is also a ROS1 inhibitor. Crizotinib has effective tumor growth inhibition .

HY-50878AS

Crizotinib-d9 hydrochloride

Crizotinib-d₉ hydrochloride is deuterated labeled Crizotinib hydrochloride (HY-50878A). Crizotinib hydrochloride (PF-02341066 hydrochloride) is an orally bioavailable, selective, and ATP-competitive dual ALK and c-Met inhibitor with IC₅₀s of 20 and 8 nM, respectively. Crizotinib hydrochloride (PF-02341066 hydrochloride) inhibits tyrosine phosphorylation of NPM-ALK and tyrosine phosphorylation of c-Met with IC₅₀s of 24 and 11 nM in cell-based assays, respectively. It is also a ROS proto-oncogene 1 (ROS1) inhibitor. Crizotinib hydrochloride (PF-02341066 hydrochloride) has effective tumor growth inhibition .

HY-50683S

JNJ-38877605-d1
JNJ-38877605-d1 (compound DO-2) is a highly selective MNNG HOS transforming (MET) inhibitor. JNJ-38877605-d1 is thought to diminish the formation of the Aldehyde Oxidase 1 inactive metabolite M3 .

HY-13016S1

Cabozantinib-d4
Cabozantinib-d₄ is deuterium labeled Cabozantinib. Cabozantinib is a potent multiple receptor tyrosine kinases (RTKs) inhibitor that inhibits VEGFR2, c-Met, Kit, Axl and Flt3 with IC50s of 0.035, 1.3, 4.6, 7 and 11.3 nM, respectively.

HY-13016S

Cabozantinib-d6
Cabozantinib-d₆ is the deuterium labeled Cabozantinib. Cabozantinib is a potent multiple receptor tyrosine kinases (RTKs) inhibitor that inhibits VEGFR2, c-Met, Kit, Axl and Flt3 with IC50s of 0.035, 1.3, 4.6, 7 and 11.3 nM, respectively[1][2][3].

HY-163992S

VTMTRDTSISTAYMELSR-(Ile-13C6,15N)
VTMTRDTSISTAYMELSR-(Ile-13C6,15N) is the ¹³C and ¹⁵N labeled isotope of VTMTRDTSISTAYMELSR .

HY-P6425S

LCADMEDV-Arg(13C6,15N4) TFA
LCADMEDV-Arg( ¹³C₆, ¹⁵N₄) TFA is a peptide containing ¹³C₆ and ¹⁵N₄ labeled Arg .

HY-P6424S

LGADMEDVCG-Arg(13C6,15N4) TFA
LGADMEDVCG-Arg( ¹³C₆, ¹⁵N₄) TFA is a peptide containing ¹³C₆ and ¹⁵N₄ labeled Arg .

HY-P1033S

[Pyr1]-Apelin-13, Gly(15N) TFA
Pyr1]-Apelin-13, Gly(15N) TFA is a Gly ¹⁵N labeled [Pyr1]-Apelin-13. [Pyr1]-Apelin-13 is a highly potent, selective endogenous apelin receptor agonist .

HY-159046S

ASGITFSNSGMHW(Val-13C5,15N)R TFA
ASGITFSNSGMHW(Val-13C5,15N)R TFA is an isotope of ASGITFSNSGMHWVR TFA labeled with ¹³C and ¹⁵N .

HY-163993S

GMDRWGQGTLVTVSS-(Leu-13C6,15N)
GMDRWGQGTLVTVSS-(Leu-13C6,15N) is the ¹³C and ¹⁵N labeled isotope of GMDRWGQGTLVTVSS .

HY-159191S

VQPGQN(Phe-13C9,15N)HMFTKEKLEEVIKDI TFA
VQPGQN(Phe- ¹³C9, ¹⁵N)HMFTKEKLEEVIKDI (TFA) is the ¹³C and ¹⁵N labeled isotope of VQPGQN-HMFTKEKLEEVIKDI (TFA) .

HY-158994S

MEGDSRGG-(Ala-13C3,15N)-GGEA-(Leu-13C6,15N)-DPESAASSLSGAS TFA
MEGDSRGG-(Ala- ¹³C₃, ¹⁵N)-GGEA-(Leu- ¹³C₆, ¹⁵N)-DPESAASSLSGAS TFA is a ¹³C- and ¹⁵N-labeled peptide containing ¹³C₃, ¹⁵N-labeled alanine (Ala) and ¹³C₆, ¹⁵N-labeled leucine (Leu).

HY-P2625S

GLP-2(3-33) (Leu-13C6,15N)
GLP-2(3-33) (Leu- ¹³C₆, ¹⁵N) is ¹³C and ¹⁵N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC₅₀=5.8 nM).

HY-P2625S1

GLP-2(3-33) (Leu-13C6,15N) TFA
GLP-2(3-33) (Leu- ¹³C₆, ¹⁵N) TFA is ¹³C and ¹⁵N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC₅₀=5.8 nM).

HY-P1142S

GLP-2(rat) (Ala-13C3,15N)
GLP-2(rat) (Ala- ¹³C3, ¹⁵N) is ¹³C and ¹⁵N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

HY-P1142S1

GLP-2(rat) (Ala-13C3,15N) TFA
GLP-2(rat) (Ala- ¹³C3, ¹⁵N) TFA is ¹³C and ¹⁵N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).

HY-P0265AS

β-Amyloid-15N (1-40) TFA
β-Amyloid- ¹⁵N (1-40) (TFA) is the ¹⁵N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].

HY-P1363S

β-Amyloid-15N (1-42), human TFA
β-Amyloid- ¹⁵N (1-42), human (TFA) is the ¹⁵N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].

Inquiry Online

Your information is safe with us. * Required Fields.

MCE Japan Authorized Agent ナミキ商事株式会社コスモ・バイオ株式会社
Salutation			Country or Region *
Applicant Name *			Organization Name *
Department *
Email Address *			Product Name *
Cat. No.			Requested quantity *
Phone Number *
Remarks

Species:	Human (8) Rhesus Macaque (3) Mouse (3) Rat (1) Cynomolgus (4) Canine (1)
Tag:	His (11) Tag Free (1) Avi (2) GST (1) Fc (5)
Source:	HEK293 (16) Sf9 insect cells (1)

Products

Cat. No.
Species
Source
Tag
Accession
Gene ID
Molecular Weight
Purity
Endotoxin Level
Biological Activity
Appearance
Formulation
Storage & Stability
Shipping
Free Sample
Size

Products

Cat. No.
Host
Reactivity
Application
Dilution Ratio
Molecular Weight
Conjugation
Clonality
Immunogen
Appearance
Isotype
Gene ID
SwissProt ID
Purity
Formulation
Free Sample
Size