Search Result
Results for "
Asn
" in MedChemExpress (MCE) Product Catalog:
1244
Inhibitors & Agonists
2
Biochemical Assay Reagents
20
Isotope-Labeled Compounds
| Cat. No. |
Product Name |
Target |
Research Areas |
Chemical Structure |
-
- HY-N0667
-
|
(-)-Asparagine; Asn; Asparamide
|
Endogenous Metabolite
|
Neurological Disease
Cancer
|
|
L-Asparagine ((-)-Asparagine) is a non-essential amino acid involved in the metabolic control of nerve and brain tissue cell function. L-Asparagine has antitumor activity .
|
-
-
- HY-111323
-
|
|
ROR
|
Neurological Disease
|
|
ASN06917370 is a former orphan receptor GPR17 ligand for the study of neurodegenerative diseases. ASN06917370 has an EC50 of 268 pM in [35S]GTPyS experiments .
|
-
-
- HY-128128
-
|
|
Others
|
Neurological Disease
|
|
ASN04421891 is a potent GPR17 receptor modulator, with an EC50 of 3.67 nM in [35S]GTPγS binding assay. ASN04421891 can be used for neurodegenerative diseases research .
|
-
-
- HY-113761
-
|
|
Filovirus
|
Infection
|
|
ASN03576800 could be a potent inhibitor for Ebola virus matrix protein VP40 in process of viral assembly and budding process. ASN03576800 occupies the RNA binding region of VP40 .
|
-
-
- HY-156586
-
|
|
OGA
Tau Protein
|
Neurological Disease
|
|
ASN90 is a specific and orally active O-GlcNAcase (OGA) enzyme inhibitor with IC50 value of 10.2 nM. ASN90 can be used for the research of neurodegenerative diseases, such as tauopathies and α-synucleinopathies .
|
-
-
- HY-113667
-
-
-
- HY-128111
-
|
|
Transmembrane Glycoprotein
|
Neurological Disease
|
|
ASN02563583, a compound that regulates the activity of the GPR17 receptor, has a IC50 value of 0.64 nM in [35S]GTPγS binding assay. ASN02563583 can be used in the study of neurological diseases .
|
-
-
- HY-136579
-
ASN007
3 Publications Verification
ERK-IN-3
|
ERK
|
Cancer
|
|
ASN007 (ERK-IN-3) is a potent and orally active inhibitor of ERK. ASN007 inhibits ERK1/2 with low single-digit nM IC50 values. ASN007 can be used for the research of cancers driven by RAS mutations .
|
-
-
- HY-164457
-
|
|
Cytochrome P450
|
Cancer
|
|
ASN-001 is an orally active CYP-17A1 lyase inhibitor that selectively inhibits testosterone synthesis. ASN-001 has anticancer activity and can be used for research in the field of prostate cancer .
|
-
-
- HY-156314
-
|
|
Flavivirus
|
Infection
|
|
ASN 07115873 is an anti-ZIKV compound (IC50: 189.2 pM), and can be used for antiviral research .
|
-
-
- HY-136579A
-
|
ERK-IN-3 benzenesulfonate
|
ERK
|
Cancer
|
|
ASN007 (ERK-IN-3) benzenesulfonate is a potent and orally active inhibitor of ERK. ASN007 benzenesulfonate inhibits ERK1/2 with low single-digit nM IC50 values. ASN007 benzenesulfonate can be used for the research of cancers driven by RAS mutations .
|
-
-
- HY-103018
-
|
Asn-002
|
JAK
Syk
|
Inflammation/Immunology
Cancer
|
|
Gusacitinib (ASN-002) is an orally active dual SYK/JAK kinase inhibitor with IC50 values of 5, 46, 4, 11 and 8 nM for SYK, JAK1, JAK2, JAK3 and TYK2, respectively. Gusacitinib rapidly and significantly suppressed key inflammatory pathways implicated in atopic dermatitis pathogenesis. Gusacitinib can be used in the research of chronic hand eczema and cancers such as basal cell carcinoma .
|
-
-
- HY-103018A
-
|
Asn-002 hydrochloride
|
JAK
Syk
|
Inflammation/Immunology
Cancer
|
|
Gusacitinib (ASN-002) hydrochloride is an orally active dual SYK/JAK kinase inhibitor with IC50 values of 5, 46, 4, 11 and 8 nM for SYK, JAK1, JAK2, JAK3 and TYK2, respectively. Gusacitinib hydrochloride rapidly and significantly suppressed key inflammatory pathways implicated in atopic dermatitis pathogenesis. Gusacitinib hydrochloride can be used in the research of chronic hand eczema and cancers such as basal cell carcinoma .
|
-
-
- HY-P2212
-
|
(Asn1,Val5)-Angiotensin II
|
Angiotensin Receptor
|
Inflammation/Immunology
|
|
Angiotensin amide ((Asn1,Val5)-Angiotensin II) is a potent vasoconstrictor. Angiotensin amide is a derivative of angiotensin II. Angiotensin amide can be used as a cardiac activator .
|
-
-
- HY-P4385
-
|
|
PTHR
|
Metabolic Disease
|
|
(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent PTH-1R antagonist .
|
-
-
- HY-144629
-
-
-
- HY-139147
-
|
Asn05260065
|
Src
|
Infection
Cancer
|
|
iHCK-37 (ASN05260065) is a potent and specific Hck inhibitor with a Ki value of 0.22 μM. iHCK-37 blocks HIV-1 viral replication with an EC50 value of 12.9 μM. iHCK-37 is used for chronic myeloid leukemia (CML) research .
|
-
-
- HY-RS01098
-
|
|
Small Interfering RNA (siRNA)
|
Others
|
|
ASNS Human Pre-designed siRNA Set A contains three designed siRNAs for ASNS gene (Human), as well as a negative control, a positive control, and a FAM-labeled negative control.
|
-
ASNS Human Pre-designed siRNA Set A
ASNS Human Pre-designed siRNA Set A
-
- HY-N0667S4
-
|
(-)-Asparagine-4-13C monohydrate; Asn-4-13C monohydrate; Asparamide-4-13C monohydrate
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Neurological Disease
|
|
L-Asparagine-4- 13C (monohydrate) is the 13C-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S2
-
|
(-)-Asparagine-15N2 monohydrate; Asn-15N2 monohydrate; Asparamide-15N2 monohydrate
|
Endogenous Metabolite
|
Neurological Disease
|
|
L-Asparagine- 15N2 (monohydrate) is the 15N-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S3
-
|
(-)-Asparagine-13C4 monohydrate; Asn-13C4 monohydrate; Asparamide-13C4 monohydrate
|
Isotope-Labeled Compounds
Endogenous Metabolite
|
Neurological Disease
|
|
L-Asparagine- 13C4 (monohydrate) is the 13C-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S7
-
|
(-)-Asparagine-13C4,15N2; Asn-13C4,15N2; Asparamide-13C4,15N2
|
Isotope-Labeled Compounds
|
Others
|
|
L-Asparagine-13C4,15N2 ((-)-Asparagine-13C4,15N2) is the 13C and 15N-labeled L-Aspartic acid. L-Aspartic acid is an amino acid, shown to be a suitable pro-agent for colon-specific drug delivery .
|
-
-
- HY-136626
-
|
Cbz-Ala-Ala-Asn-AMC
|
Fluorescent Dye
|
Cancer
|
|
Z-Ala-Ala-Asn-AMC (Cbz-Ala-Ala-Asn-AMC) is the legumain substrate. Overexpressed legumain in 293 HEK-Leg cells potently cleaved CBZ-Ala-Ala-Asn-AMC .
|
-
-
- HY-W009085
-
-
-
- HY-W008233
-
-
-
- HY-148393
-
-
-
- HY-W002327
-
|
|
Biochemical Assay Reagents
|
Others
|
|
Fmoc-Asn(Trt)-OH is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Fmoc-Asn(Trt)-OH can be used for synthesis of Fmoc-based solid-phase peptide synthesis .
|
-
-
- HY-P3220
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin .
|
-
![[D-Asn5]-Oxytocin](//file.medchemexpress.eu/product_pic/hy-p3220.gif)
-
- HY-131092
-
-
-
- HY-150242A
-
|
|
Others
|
Others
|
|
Cbz-Ala-Ala-Asn TFA is a peptide that designed based on the sequence of the substrate of legumain. Legumain is a cysteine protease. Cbz-Ala-Ala-Asn TFA can be applied as a scaffold for drug delivery .
|
-
-
- HY-139245
-
|
|
ADC Linker
|
Cancer
|
|
MC-Ala-Ala-Asn-PAB is a linker extracted from patent CN104147612A, page 14. MC-Ala-Ala-Asn-PAB can be used to synthesis the tumor microenvironment specific activated micromolecular targeted conjugate .
|
-
-
- HY-129360
-
|
|
ADC Linker
|
Cancer
|
|
Ala-Ala-Asn-PAB is a peptide cleavable ADC linker for antibody-drug conjugates (ADCs) .
|
-
-
- HY-151146
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
(1R,3S)-THCCA-Asn (4j) is a selective thrombin inhibitor with the IC50 value in the range of 0.07 to 0.14 μM. ((1R,3S)-THCCA-Asn has antithrombotic activity .
|
-
-
- HY-129360A
-
|
|
ADC Linker
|
Cancer
|
|
Ala-Ala-Asn-PAB TFA is a peptide cleavable ADC linker for antibody-drug conjugates (ADCs) .
|
-
-
- HY-129361
-
-
-
- HY-144628
-
|
|
ADC Linker
|
Cancer
|
|
Fmoc-Asn-Pro-Val-PABC-PNP (compound 6) is a potent ADC Linker .
|
-
-
- HY-148392
-
-
-
- HY-130933
-
|
|
ADC Linker
|
Cancer
|
|
Fmoc-Ala-Ala-Asn(Trt)-OH is a cleavable ADC linker used in the synthesis of antibody-drug conjugates (ADCs) .
|
-
-
- HY-P3615
-
-
![[Asn18] Endothelin-1, human](//file.medchemexpress.eu/product_pic/hy-p3615.gif)
-
- HY-148031
-
|
|
ADC Linker
|
Others
|
|
MC-Ala-Ala-Asn-PAB-PNP is a peptide, can be used to synthesize specifically activated micromolecular target coupling body .
|
-
-
- HY-141464
-
|
Fmoc-Asn(Ac3AcNH-beta-Glc)-OH
|
Amino Acid Derivatives
|
Cancer
|
|
Fmoc-L-Asn(beta-D-GlcNAc(Ac)3)-OH (Fmoc-Asn(Ac3AcNH-beta-Glc)-OH) can be used in the synthesis of silicon-fluoride acceptor (SiFA) derivatized octreotate derivatives. SiFA-octreotate analogues, as tumor imaging agents, are useful tool for the research of positron emission tomography (PET) .
|
-
-
- HY-144630
-
-
-
- HY-P2397
-
-
-
- HY-P2401
-
-
-
- HY-141152
-
-
-
- HY-157338
-
|
|
ADC Linker
Kinesin
|
Cancer
|
|
NHS-Ala-Ala-Asn-active metabolite is a cleavable antibody-drug conjugate (ADC) linker for synthesis of kinesin spindle protein (KSP)inhibitor .
|
-
-
- HY-N9446
-
|
|
Endogenous Metabolite
|
Others
|
|
H-Asn(glcnac-beta-D)-OH is an endogenous metabolite present in Urine that can be used for the research of NGLY1-CDDG .
|
-
-
- HY-P4019
-
|
|
HIV Protease
|
Others
|
|
Ac-Ser-Gln-Asn-Tyr-Pro-Val-Val-NH2 is a substrato peptídico of HIV-1 protease. Ac-Ser-Gln-Asn-Tyr-Pro-Val-Val-NH2 acts as the variable substrate in a peptidolytic assay to quantify the inhibition of the protease .
|
-
-
- HY-141149
-
|
|
ADC Linker
|
Cancer
|
|
Fmoc-PEG4-Ala-Ala-Asn-PAB is a cleavable 4 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs) .
|
-
-
- HY-141150
-
|
|
ADC Linker
|
Cancer
|
|
Azido-PEG5-Ala-Ala-Asn-PAB is a cleavable 5 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs) . Azido-PEG5-Ala-Ala-Asn-PAB is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.
|
-
- HY-141153
-
|
|
ADC Linker
|
Cancer
|
|
Fmoc-PEG3-Ala-Ala-Asn(Trt)-PAB-PNP is a cleavable linker for synthesis of antibody-drug conjugates (ADCs) .
|
-
- HY-141151
-
|
|
ADC Linker
|
Cancer
|
|
Fmoc-PEG3-Ala-Ala-Asn(Trt)-PAB is a cleavable 3 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs) .
|
-
- HY-136733
-
|
Ac-Asp-Asn-Leu-Asp-CHO
|
Caspase
|
Infection
Neurological Disease
|
|
Ac-DNLD-CHO (Ac-Asp-Asn-Leu-Asp-CHO) is a Caspase-3/7 inhibitor (IC50: 9.89, 245 nM respectively; Ki app: 0.68, 55.7 nM respectively). Ac-DNLD-CHO can be used for research of caspase-mediated apoptosis diseases, such as neurodegenerative disorders and viral infection diseases .
|
-
- HY-W010378
-
|
H-D-Asn-OH
|
Endogenous Metabolite
|
Metabolic Disease
|
|
D-Asparagine (H-D-Asn-OH) is a competitive inhibitor of L-Asparagine hydrolysis with a Ki value of 0.24 mM. D-Asparagine is a source of nitrogen for yeast strains. D-Asparagine is a good substrate for the external yeast asparaginase but is a poor substrate for the internal enzyme .
|
-
- HY-114174
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing and mediates APP proteolytic processing .
|
-
- HY-W091365
-
|
N-Boc-N'-xanthyl-L-asparagine
|
Amino Acid Derivatives
|
Others
|
|
Boc-Asn(Xan)-OH (N-Boc-N'-xanthyl-L-asparagine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize locust fat growth hormone .
|
-
- HY-P1962
-
|
[Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)
|
Beta-secretase
|
Neurological Disease
|
|
β-Secretase inhibitor ([Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)) is a β-secretase and BACE1 inhibitor (IC50: 25 nM for β-secretase) .
|
-
- HY-W002327S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
Fmoc-Asn(Trt)-OH- 13C4, 15N2 is a 15N-labeled and 13C-labled 4-(4-(tert-Butyl)-2-ethoxyphenyl)-2-(2,6-difluorophenyl)-4,5-dihydrooxazole[1].
|
-
- HY-P5415
-
|
|
HIV
|
Others
|
|
DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS is a biological active peptide. (DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS is also called HIV protease substrate I in some literature. It is widely used for the continuous assay for HIV protease activity. The 11-kD protease (PR) encoded by the human immunodeficiency virus 1 (HIV-1) is essential for the correct processing of viral polyproteins and the maturation of infectious virus, and is therefore a target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics. The FRET-based fluorogenic substrate is derived from a natural processing site for HIV-1 PR. Incubation of recombinant HIV-1 PR with the fluorogenic substrate resulted in specific cleavage at the Tyr-Pro bond and a time-dependent increase in fluorescence intensity that is linearly related to the extent of substrate hydrolysis. The fluorescence quantum yields of the HIV-1 PR substrate in the FRET assay increased by 40.0- and 34.4-fold, respectively, per mole of substrate cleaved. Because of its simplicity and precision in the determination of reaction rates required for kinetic analysis, this substrate offers many advantages over the commonly used HPLC or electrophoresis-based assays for peptide substrate hydrolysis by retroviral PRs. Abs/Em = 340nm/490nm.)
|
-
- HY-151829
-
|
|
ADC Linker
|
Others
|
|
Fmoc-L-Asn(EDA-N3)-OH is a click chemistry reagent containing an azide group. This building block is reported in literature for the modification of Amanitin via Click Chemistry. Alpha-Amanitin is the deadliest member of the amatoxin peptide family produced by the death-cap mushroom A. phalloides. It is an orally available, rigid, bicyclic octapeptide and one of the most lethal known natural products (LD50 = 50-100 μg/kg) acting as highly selective allosteric inhibitor of the RNA polymerase II . It contains an azide group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing alkyne groups. It can also undergo ring strain-promoted alkyne-azide cycloaddition (SPAAC) with molecules containing DBCO or BCN groups.
|
-
- HY-149360
-
|
|
P-glycoprotein
|
Cancer
|
|
P-gb-IN-1 (compound Ⅲ-8), a 2,5-disubstituted furan derivative, is a highly effective, broadspectrum P-glycoprotein (P-gp) inhibitor. P-gb-IN-1 displayed the reversal activity by inhibiting P-gp efflux. P-gb-IN-1 has a potent affinity to P-gp by forming H-bond interactions with residues Asn 721 and Met 986. P-gb-IN-1 possesses broad-spectrum reversal activity and low toxicity in MCF-7/ADR cells .
|
-
- HY-P1043A
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide Trifluoroacetatecontaining the Asn-Gly-Arg (NGR) motif. NGR peptide Trifluoroacetate binds to APN/CD13. NGR peptide Trifluoroacetate is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-P1043
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide containing the Asn-Gly-Arg (NGR) motif. NGR peptide binds to APN/CD13. NGR peptide is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-128946
-
|
|
Drug-Linker Conjugates for ADC
|
Inflammation/Immunology
Cancer
|
|
CL2A-SN-38 is a agent-linker conjugate composed of a potent a DNA Topoisomerase I inhibitor SN-38 and a linker CL2A to make antibody agent conjugate (ADC). CL2A-SN-38 provides significant and specific antitumor effects against a range of human solid tumor types. CL2A-SN-38 uses hydrolyzable linker to deliver active agents within tumor cells and in the tumor microenvironment, resulting in bystander effects .
|
-
- HY-W010719
-
-
- HY-E70068
-
|
|
Others
|
Others
|
|
Endo-β-N-acetylglucosaminidase (Endo S) is a family 18 glycosyl hydrolase secreted by Streptococcus pyogenes. Endo-β-N-acetylglucosaminidase (Endo S) exclusively hydrolyzes the β-1,4-di-N-acetylchitobiose core of the asparagine-linked complex-type glycan on Asn-297 of the γ-chains of IgG antibody .
|
-
- HY-P1610
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Asudemotide (S-588410) is a peptide of human DEP domain-containing protein 1A. Asudemotide is an immunostimulant. Asudemotide has a sequence of H-Glu-Tyr-Tyr-Glu-Leu-Phe-Val-Asn-Ile-OH. Asudemotide induces a tumor immune response in esophageal cancer. .
|
-
- HY-14874
-
|
FYX-051
|
Xanthine Oxidase
Cytochrome P450
|
Metabolic Disease
|
|
Topiroxostat (FYX-051) is a potent and orally active xanthine oxidoreductase (XOR) inhibitor with an IC50 value of 5.3 nM and a Ki value of 5.7 nM. Topiroxostat exhibits weak CYP3A4-inhibitory activity (18.6%). Topiroxostat has the potential for hyperuricemia treatment .
|
-
- HY-14874R
-
|
|
Xanthine Oxidase
Cytochrome P450
|
Metabolic Disease
|
|
Topiroxostat (Standard) is the analytical standard of Topiroxostat. This product is intended for research and analytical applications. Topiroxostat (FYX-051) is a potent and orally active xanthine oxidoreductase (XOR) inhibitor with an IC50 value of 5.3 nM and a Ki value of 5.7 nM. Topiroxostat exhibits weak CYP3A4-inhibitory activity (18.6%). Topiroxostat has the potential for hyperuricemia treatment .
|
-
- HY-112205A
-
|
|
Parasite
Legumain
|
Infection
|
|
RR-11a analog is a potent and irreversible inhibitor of Schistosoma mansoni legumain, with an IC50 of 31 nM. RR-11a analog is an aza-Asn derivative and aza-peptide Michael acceptor .
|
-
- HY-118731
-
|
|
Reverse Transcriptase
|
Infection
|
|
TNK-6123 is a potent Emivirine (HY-15353) analogue with improved activity against drug-resistant HIV mutants. TNK-6123 improves activity against Lys103Asn mutant RT .
|
-
- HY-P4919
-
|
|
Beta-secretase
|
Others
|
|
Mca-SEVNLDAEFK(Dnp) is a Beta-secretase 1 (BACE-1) peptide FRET substrate, containing the 'Swedish' Lys-Met/Asn-Leu mutation of the amyloid precursor protein (APP) β-secretase cleavage site. Cleavage at -Leu-Asp- of Mca-SEVNLDAEFK(Dnp) liberates the highly fluorescent 7-methoxycoumarin (Mca) fragment from the proximity quenching effect of the 2,4-dinitrophenyl (Dnp) internal quencher resulting in a large and easily detectable increase in fluorescence intensity.
|
-
- HY-128923
-
|
3-Mercaptopicolinic acid hydrochloride; 3-MPA hydrochloride
|
PEPCK
|
Metabolic Disease
|
|
SKF-34288 (3-Mercaptopicolinic acid) hydrochloride is an orally active phosphoenolpyruvate carboxykinase (PEPCK) inhibitor (Ki: 2-9 μM). SKF-34288 hydrochloride is a potent hypoglycemic agent by inhibiting glucose synthesis. SKF-34288 hydrochloride also inhibits Asn metabolism and increases amino acids and amides .
|
-
- HY-108625
-
SHA 68
1 Publications Verification
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
SHA 68 is a potent and selective non-peptide neuropeptide S receptor (NPSR) antagonist with IC50s of 22.0 and 23.8 nM for NPSR Asn 107 and NPSR Ile 107, respectively. SHA 68 has limited the blood-brain barrier (BBB) penetration and the activity in neuralgia .
|
-
- HY-150787
-
|
|
FXR
Cytochrome P450
|
Metabolic Disease
|
|
BMS-986339 is an orally active, potent FXR agonist. BMS-986339 forms H-bond with His298 and ASN287 residues. BMS-986339 can be used in the research of primary biliary cirrhosis (PBC), primary sclerosing cholangitis (PSC), and nonalcoholic steatohepatitis (NASH), anti-fibrosis .
|
-
- HY-P3882
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Gln-Lys-NH2 (AEQK) is a tetrapeptide. Fmoc-Ala-Glu-Gln-Lys-NH2 is the inactive control for Fmoc-Ala-Glu-Asn-Lys-NH2 (AENK) peptide inhibitor. AENK blocks proteolysis of UNC5C protein .
|
-
- HY-128947
-
|
|
ADC Linker
|
Cancer
|
|
CL2 Linker is a cleavableADC linker. CL2-SN-38 and CL2A-SN-38 are equivalent in agent substitution (~6), cell binding (Kd ~1.2 nM), cytotoxicity (IC50 ~2.2 nM), and serum stability in vitro (t1/2 ~20 hours) .
|
-
- HY-164668
-
|
|
Antibody-Drug Conjugates (ADCs)
|
Cancer
|
|
ADC Control Human IgG1-SN-38 is an isotype control of ADC Human IgG1-SN-38. The antibody portion is Human IgG1 kappa, Isotype Control (HY-P99001), and the drug-linker conjugate for ADC is CL2A-SN-38 (HY-128946).
|
-
- HY-162238
-
|
|
Parasite
|
Infection
|
|
OSM-S-106 is a pro-inhibitor and that inhibition of PfAsnRS occurs via enzyme-mediated production of an Asn-OSM-S-106 adduct. OSM-S-106 inhibits protein translation and activates the amino acid starvation response. OSM-S-106 exhibits selective activity against Plasmodium blood and liver stages and low intrinsic clearance by human microsomes .
|
-
- HY-123319A
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Antofloxacin is a well tolerate, orally active and broad-spectrum 8-amino-fluoroquinolone with potent antibacterial activities. Antofloxacin shows superior antibacterial activity against gyrA mutation-positive H. pylori strains, especially in Asn87- mutated strains, compared to levofloxacin. Antofloxacin is a weak, reversible inhibitor of CYP1A2 for the research of infections caused by a diverse group of bacterial species .
|
-
- HY-123319
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
Antofloxacin hydrochloride is a well tolerate, orally active and broad-spectrum 8-amino-fluoroquinolone with potent antibacterial activities. Antofloxacin hydrochloride shows superior antibacterial activity against gyrA mutation-positive H. pylori strains, especially in Asn87- mutated strains, compared to levofloxacin. Antofloxacin hydrochloride is a weak, reversible inhibitor of CYP1A2 for the research of infections caused by a diverse group of bacterial species .
|
-
- HY-125028
-
|
|
Src
HIV
|
Infection
|
|
Hck-IN-1 (compound B9), a diphenylpyrazolo compound, is a selective Nef-dependent Hck inhibitor with IC50s of 2.8 μM, >20 μM for Nef:Hck complex and Hck, respectively. Hck-IN-1 is a direct and wide HIV-1 Nef antagonists with an IC50 of 100-300 nM for wild-type HIV-1 replication. Hck-IN-1 binds pocket residue Asn126 and has anti-retroviral activity .
|
-
- HY-W088100
-
|
N-Boc-N'-trityl-D-asparagine; Boc-D-Asn(Trt)-OH
|
Amino Acid Derivatives
|
Cancer
|
|
Boc-N-gamma-trityl-D-asparagin (N-Boc-N'-trityl-D-asparagine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize metastasis-inhibiting or tumor growth-inhibiting metastasis-inhibiting MS derivatives .
|
-
- HY-B1803A
-
|
ICI 136753 hydrochloride
|
GABA Receptor
|
Neurological Disease
|
|
Tracazolate (ICI 136753) hydrochloride is a potent GABAA receptor modulator. Tracazolate hydrochloride has selectivity for β3 and potentiates α1β1γ2s (EC50=13.2 μM), α1β3γ2 (EC50=1.5 μM). Tracazolate hydrochloride has the potency (EC50) determined by the nature of the third subunit (γ1-3, δ, ε) within the receptor complex. Tracazolate hydrochloride possesses anxiolytic and anticonvulsant activity .
|
-
- HY-N0667R
-
|
|
Endogenous Metabolite
|
Neurological Disease
Cancer
|
L-Asparagine (Standard) is the analytical standard of L-Asparagine. This product is intended for research and analytical applications. L-Asparagine ((-)-Asparagine) is a non-essential amino acid involved in the metabolic control of nerve and brain tissue cell function. L-Asparagine has antitumor activity .
In Vitro:L-Asparagine (0.03 mM) can reverse the proliferation decline of six human cancer cells induced by ASNS siRNA knockdown .
L-Asparagine (10 mM, 4 h) can stimulate ODC activity and proliferation in IPEC-J2 cells .
|
-
- HY-122179
-
|
|
TGF-β Receptor
|
Inflammation/Immunology
|
|
NUCC-555 is an activin antagonist. NUCC-555 interacts with Trp25, Trp28, Phe55, Tyr93, Lys103, and Asn107 in the Activin A binding pocket. NUCC-555 blocks Activin A-mediated hepatic stellate cells (HSCs) activation. NUCC-555 promotes liver regeneration and halts fibrosis progression in chronic liver disease models. NUCC-555 inhibits Activin A-mediated ovarian cell proliferation. NUCC-555 decreases FSH levels in ovariectomized mice .
|
-
- HY-150579
-
|
|
Keap1-Nrf2
|
Inflammation/Immunology
Cancer
|
|
Keap1-Nrf2-IN-13 is a Keap1-Nrf2 protein–protein interaction (PPI) inhibitor with an IC50 value of 0.15 μM. Keap1-Nrf2-IN-13 has strong binding affinities to the Keap1 protein by forming hydrogen bond with the key polar residues (Asn414, Arg415, Arg483, Gln530). Keap1-Nrf2-IN-13 can be used in the research of oxidative stress-related and inflammatory diseases, including pulmonary fibrosis, chronic obstructive pulmonary disorder (COPD) and cancers .
|
-
- HY-P3465
-
|
Myrcludex B
|
HBV
|
Infection
|
|
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research .
|
-
- HY-P5174
-
|
|
Sodium Channel
|
Neurological Disease
|
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
-
- HY-P4327
-
|
|
Bacterial
|
Infection
|
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative .
|
-
- HY-P3021
-
|
|
Bacterial
Biochemical Assay Reagents
|
Infection
|
|
Human milk lysozyme is the lysozyme found in human milk. Human milk lysozyme is thought to be a key defense factor in protecting the gastrointestinal tract of newborns against bacterial infection .
|
-
- HY-P0058A
-
-
- HY-P0058
-
-
- HY-P0058B
-
-
- HY-P1464
-
|
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
-
- HY-P1070
-
|
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1871
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P1070A
-
|
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
-
- HY-P1871A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
-
- HY-P4928
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P4928A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
-
- HY-P4911
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
-
- HY-P5783
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P4911A
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research .
|
-
- HY-P2145
-
|
EDF
|
Bacterial
|
Infection
|
|
Extracellular death factor (EDF) is the only single signaling molecule involved in Escherichia coli quorum sensing, and can initiate MAZEF-mediated cell death. Extracellular death factor significantly amplifies the endoribonucleolytic activities of both MazF and ChpBK .
|
-
- HY-P1473
-
|
Amylin (8-37) (mouse, rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
|
-
- HY-P2501
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological hallmark of type II diabetes mellitus .
|
-
- HY-P4785
-
-
- HY-P1858
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
-
- HY-P1858A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
-
- HY-P3019
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with Ki values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion .
|
-
- HY-P5816
-
|
|
Sodium Channel
|
Neurological Disease
|
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
-
- HY-P3462
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
-
- HY-P3462A
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
-
- HY-P5142
-
|
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
-
- HY-P10801
-
|
C46 peptide
|
HIV
|
Infection
|
|
mC46 (C46) peptide is a membrane-associated fusion peptide inhibitor. mC46 peptide potently inhibits HIV-1 replication and entry. mC46 also inhibits CCR5-tropic, CXCR4-tropic, and dual-tropic HIVs, SIV, and SHIV .
|
-
- HY-P3012
-
|
|
Cathepsin
|
Inflammation/Immunology
|
|
Cathepsin G acts as a potent agonist of human platelet activation leading to their aggregation., and can be used for screening of relevant inhibitors .
|
-
- HY-P10327
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
PP18 is a novel OXM-based dual GLP-1 and glucagon receptor agonist with EC50 values of 0.487 nM target hGLP-1R and 0.188 nM target hGcgR .
|
-
- HY-P1441
-
|
|
Sodium Channel
|
Others
|
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
-
- HY-P4933
-
|
|
Tau Protein
|
Others
|
|
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5863
-
|
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
-
- HY-P10323
-
|
Tumstatin (74-98), human
|
Integrin
FAK
mTOR
Apoptosis
|
Cancer
|
|
T7 peptide is an endothelial cell-specific inhibitor. T7 peptide interacts with αVβ3 integrin to inhibit the FAK, PI3-kinase, PKB/Akt, and mTOR signaling pathways in endothelial cells, ultimately suppressing protein synthesis and inducing apoptosis .
|
-
- HY-P5899
-
-
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
-
- HY-P5497
-
|
|
HIV
|
Others
|
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
-
- HY-P1144
-
|
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
-
- HY-P5846
-
|
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
-
- HY-P1443
-
|
|
Sodium Channel
|
Cancer
|
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
-
- HY-P10384
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-2 (Compound CP2) is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 21 nM. SPSB2-iNOS inhibitory cyclic peptide-2 is reduction-resistant and oxidatively stable .
|
-
- HY-P1542
-
|
Catostomus urotensin I
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
|
Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
-
- HY-P1542B
-
|
Catostomus urotensin I TFA
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
|
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
-
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
-
- HY-P2710
-
|
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
-
- HY-P10352
-
|
|
Bacterial
|
Infection
|
|
Pediocin PA-1 is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogens such as Listeria monocytogenes and Gram-positive bacteria. Pediocin PA-1 can be used as a food biopreservative .
|
-
- HY-P10352A
-
|
|
Bacterial
|
Infection
|
|
Pediocin PA-1 TFA is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogens such as Listeria monocytogenes and Gram-positive bacteria. Pediocin PA-1 TFA can be used as a food biopreservative .
|
-
- HY-P2322
-
-
- HY-P5584
-
-
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
-
- HY-P3641
-
|
|
GnRH Receptor
|
Neurological Disease
Metabolic Disease
|
|
Kisspeptin 13 inhibits glucose-induced insulin secretion with an IC50 of 1.2 nM. Kisspeptin 13 activates the hypothalamic-pituitary-adrenal (HPA) axis, causes hyperthermia, motor behavior and anxiety in rats. Kisspeptin 13 interacts with α2-adrenergic and 5-HT2 serotonin receptors, exhibits antidepressant efficacy. Kisspeptin 13 is an activator for GPR54 and GnRH receptor, which enhances memory and can be used in Alzheimer's disease research .
|
-
- HY-P10383
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
-
- HY-P3641A
-
|
|
GnRH Receptor
|
Neurological Disease
Metabolic Disease
|
|
Kisspeptin 13 TFA is the TFA salt form of Kisspeptin 13 (HY-P3641). Kisspeptin-13 TFA inhibits glucose-induced insulin secretion with an IC50 of 1.2 nM. Kisspeptin 13 TFA activates the hypothalamic-pituitary-adrenal (HPA) axis, causes hyperthermia, motor behavior and anxiety in rats. Kisspeptin 13 TFA interacts with α2-adrenergic and 5-HT2 serotonin receptors, exhibits antidepressant efficacy. Kisspeptin 13 TFA is an activator for GPR54 and GnRH receptor, which enhances memory and can be used in Alzheimer's disease research .
|
-
- HY-P10457
-
|
15-PGDH (92-105)
|
15-PGDH
|
Others
|
|
5-Hydroxy prostaglandin dehydrogenase blocking peptide (15-PGDH (92-105)) is a blocking peptide that corresponds to the amino acids (AGVNNEKNWEKTLQ) located at positions 92-105 of the 15-hydroxy prostaglandin dehydrogenase (15-PGDH) sequence. 5-Hydroxy prostaglandin dehydrogenase blocking peptide can block the formation of protein-antibody complexes during immunohistochemical analysis of 15-PGDH .
|
-
- HY-P10489
-
|
|
Kisspeptin Receptor
|
Others
Cancer
|
|
Kisspeptin-14 human is a peptide hormone encoded by the KiSS-1 gene. Kisspeptin-14 human, along with several other similar peptide hormones, is produced from a common precursor protein by cleavage by different proteases. Kisspeptin-14 human has the same receptor binding efficiency and potency as full-length kisspeptin. Kisspeptin-14 human binds to its receptor GPR54 and is able to activate this G protein-coupled receptor and activate multiple intracellular signaling pathways. Kisspeptin-14 human can be used to study reproductive development and tumor metastasis .
|
-
- HY-P10798
-
-
- HY-P10586
-
|
MALP-2
|
Toll-like Receptor (TLR)
NO Synthase
|
Cardiovascular Disease
|
|
Macrophage-activating lipopeptide 2 (MALP-2) is an agonist of Toll like receptors TLR-2/TLR-6. Macrophage-activating lipopeptide-2 can enhance endothelial nitric oxide synthase (eNOS) phosphorylation and endothelial cell release of NO, thereby improving vasodilation. Macrophage-activating lipopeptide-2 can enhance endothelial adhesion of white blood cells and improve perfusion recovery and collateral growth in the hind limbs of hypercholesterolemic Apoe deficient mice undergoing experimental femoral artery ligation (FAL) .
|
-
- HY-P10586A
-
|
MALP-2 TFA
|
Toll-like Receptor (TLR)
NO Synthase
|
Cardiovascular Disease
Metabolic Disease
|
|
Macrophage-activating lipopeptide 2 TFA is an agonist of Toll like receptors TLR-2/TLR-6. Macrophage-activating lipopeptide-2 enhances endothelial nitric oxide synthase (eNOS) phosphorylation and endothelial cell release of NO, thereby improving vasodilation. Macrophage-activating lipopeptide-2 enhances endothelial adhesion of white blood cells and improve perfusion recovery and collateral growth in the hind limbs of hypercholesterolemic Apoe deficient mice undergoing experimental femoral artery ligation (FAL) .
|
-
- HY-P3055
-
|
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
|
Dendrotoxin-I (DTX-I) is a potent K + channels blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6, respectively. Dendrotoxin-I, a neurotoxin, has the potential for cancer research .
|
-
- HY-P5797
-
-
- HY-P2707
-
|
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research .
|
-
- HY-P3055A
-
|
DTX-I TFA
|
Potassium Channel
|
Cancer
|
|
Dendrotoxin-I (DTX-I) TFA is a potent K + channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research .
|
-
- HY-P1023
-
|
|
GCGR
|
Metabolic Disease
|
|
VIP(6-28)(human, rat, porcine, bovine) is an effective antagonist of the actions of exogenous vasoactive intestinal peptide (VIP) on cAMP.
|
-
- HY-P4816
-
|
|
Bacterial
Fungal
|
Infection
Inflammation/Immunology
|
|
Pseudin-2, an AMP thast could be isolated from the skin of the South American paradoxical frog Pseudis paradoxa, exert a potent growth inhibitory effect against Gram-negative bacteria .
|
-
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
-
- HY-P5851
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
-
- HY-P5172
-
|
|
Sodium Channel
|
Neurological Disease
|
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
-
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
-
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
-
- HY-P5623
-
|
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-P5005
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study of cancers such as non-small cell lung cancer (NSCLC) .
|
-
- HY-P5623B
-
|
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
-
- HY-158992S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
SP-(Val- 13C5, 15)-EKNQ-(Leu- 13C6, 15)-TIDFINIVKDPVPHNEYKT TFA is a 13C- and 15N-labeled peptide containing 13C5, 15N-labeled valine (Val) and 13C6, 15N-labeled leucine (Leu).
|
-
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P5144
-
-
- HY-P5857
-
|
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
-
- HY-P5860
-
|
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
-
- HY-P5175
-
|
|
mAChR
|
Neurological Disease
|
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
-
- HY-P10572
-
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
-
- HY-P1014
-
-
- HY-P1127
-
-
- HY-P5623A1
-
|
RVG29-Cys acetate; RDP-Cys acetate; Rabies Virus Glycoprotein-29-Cys acetate
|
RABV
|
Others
|
|
RVG-Cys (RVG29-Cys;RDP-Cy) acetate is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
-
- HY-P5623A
-
|
RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys
|
RABV
|
Others
|
|
RVG-Cys (RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
-
- HY-P5912
-
|
|
iGluR
|
Neurological Disease
|
|
GluN1 (356-385) is an antigenic peptide against
N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the
effect of reducing the density of surface NMDAR clusters in hippocampal
neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR
encephalitis .
|
-
- HY-P2516
-
|
|
Tau Protein
|
Neurological Disease
|
|
Tau Peptide (275-305) (Repeat 2 domain) is the Alzheimer's tau fragment R2, corresponding to the second repeat unit of the microtubule-binding domain, which is believed to be pivotal to the biochemical properties of full tau protein .
|
-
- HY-P3899
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
-
![[Nle8] Somatostatin (1-28)](//file.medchemexpress.eu/product_pic/hy-p3899.gif)
- HY-P3954
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
-
- HY-P3899A
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
[Nle8] Somatostatin (1-28) TFA is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) TFA increases the amylase release.[Nle8] Somatostatin (1-28) TFA increases the cyclic AMP in pancreatic acini .
|
-
![[Nle8] Somatostatin (1-28) (TFA)](//file.medchemexpress.eu/product_pic/hy-p3899a.gif)
- HY-P4373
-
|
|
Cathepsin
MMP
|
Metabolic Disease
|
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
-
- HY-P4373A
-
|
|
Cathepsin
MMP
|
Inflammation/Immunology
|
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
-
- HY-P2625S1
-
|
|
Isotope-Labeled Compounds
GCGR
|
Metabolic Disease
|
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
- HY-P2625S
-
|
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
- HY-P5354
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm). .
|
-
- HY-P5833
-
|
κ-Bgt
|
nAChR
|
Neurological Disease
|
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
-
- HY-P1024
-
|
GLP-2 (human); Glucagon-like peptide 2 (human)
|
GCGR
|
Metabolic Disease
|
|
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
|
-
- HY-P1841
-
|
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
-
- HY-P1142
-
|
|
Apoptosis
|
Others
|
|
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
-
- HY-P1142A
-
|
|
Apoptosis
|
Others
|
|
GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
-
- HY-P4835
-
|
|
Phosphatase
|
Others
|
|
pTH (2-34) (human) (80 μg/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone extract (markers of bone formation) in mice. pTH (2-34) is not as effective as pTH (1-34) .
|
-
- HY-P10654
-
-
- HY-P0059
-
|
Human parathyroid hormone-(1-34); hPTH (1-34)
|
PTHR
Thyroid Hormone Receptor
|
Others
Cancer
|
|
Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research .
|
-
- HY-P1142S1
-
|
|
Isotope-Labeled Compounds
Apoptosis
|
Others
|
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
- HY-P1142S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
- HY-P4862
-
|
|
PTHR
|
Others
|
|
Biotinyl-pTH (1-34) (human) is abiotinylated Teriparatide (HY-P0059).
|
-
- HY-P5719
-
|
|
Bacterial
|
Infection
|
|
Andropin is a male-specific antibacterial peptide that can be found in Drosophila melanogaster .
|
-
- HY-P10844
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer .
|
-
- HY-P2510
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns .
|
-
- HY-P5157
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
-
- HY-P4823
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
pTH (1-37) (human) is a fragment of parathyroid hormone (PTH). pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis .
|
-
- HY-P0052
-
|
T20; DP178
|
HIV
|
Infection
|
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P0052A
-
|
T20 acetate; DP178 acetate
|
HIV
|
Infection
|
|
Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
|
-
- HY-P10622
-
|
|
Apoptosis
Reactive Oxygen Species
|
Metabolic Disease
Cancer
|
|
SHLP-3 is a mitochondrial derived peptide encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP-3 increases cell viability and reduces apoptosis in insulinoma NIT-1β cells and human prostate cancer 22Rv1 cells. SHLP-3 increases mitochondrial function and exerts cytoprotective effects by increasing mitochondrial oxygen consumption rate (OCR), cellular ATP and reducing the ability to produce ROS. SHLP-3 can be used in the study of diabetes and cancer .
|
-
- HY-P5625
-
|
|
Bacterial
|
Infection
|
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
-
- HY-P0203
-
|
CGRP (83-119), mouse, rat
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
-
- HY-P1071
-
|
Calcitonin gene-related peptide
|
CGRP Receptor
|
Cardiovascular Disease
|
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
-
- HY-P1071A
-
|
Calcitonin gene-related peptide TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
-
- HY-P2542
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo .
|
-
- HY-P4086
-
|
|
RABV
|
Infection
|
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction .
|
-
- HY-P2949
-
|
|
Potassium Channel
|
Cancer
|
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
-
- HY-P1218B
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
-
- HY-P0276
-
|
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
-
- HY-P1548
-
|
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P1548A
-
|
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
-
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
-
- HY-P1548B
-
|
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
-
- HY-P0276A
-
|
Gastric Inhibitory Peptide (GIP), human TFA
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
-
- HY-P1410
-
|
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
-
- HY-P3580
-
|
Human N-acetyl GIP
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P3584
-
|
(Pro3) Gastric Inhibitory Peptide, human
|
Insulin Receptor
|
Metabolic Disease
|
|
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes .
|
-
- HY-P3580A
-
|
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .
|
-
- HY-P5865
-
|
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
-
- HY-P1410B
-
-
- HY-P3247
-
|
|
Insulin Receptor
|
Neurological Disease
Metabolic Disease
|
|
[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc
|
-
![[D-Ala2]-GIP (human)](//file.medchemexpress.eu/product_pic/hy-p3247.gif)
- HY-P1410C
-
-
- HY-P3584A
-
|
(Pro3) Gastric Inhibitory Peptide, human TFA
|
Insulin Receptor
|
Metabolic Disease
|
|
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes .
|
-
- HY-P0191
-
-
- HY-P0191A
-
-
- HY-P5184
-
|
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
-
- HY-P5854
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
-
- HY-P4692
-
-
- HY-P2289
-
|
pBD-1
|
Bacterial
|
Infection
|
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P1022
-
|
Metastin(human)
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion .
|
-
- HY-P1022A
-
|
Metastin(human) TFA
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Kisspeptin-54(human) TFA (Metastin(human) TFA) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) TFA binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) TFA hinders tumor metastasis and stimulates gonadotropin secretion .
|
-
- HY-P1189
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P1189A
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
-
- HY-P3479
-
-
- HY-P5551
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells .
|
-
- HY-P1788
-
|
|
Influenza Virus
|
Infection
|
|
Influenza A NP(366-374) Strain A/PR/8/35 is an H2-Db-restricted epitope from Influenza A/PR/8/35 nucleoprotein .
|
-
- HY-P3429A
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
-
- HY-P10689
-
|
|
SARS-CoV
|
Infection
|
|
NQK-A8 peptide is an immunodominant peptide of seasonal coronaviruses HKU1-CoV and OC43-CoV .
|
-
- HY-P10688
-
-
- HY-P1890
-
|
|
EBV
|
Infection
|
|
CEF14, EBV Rta Protein (28-37) is the HLA A24-restricted epitope from Epstein-Barr Virus Rta protein (28-37).
|
-
- HY-P3199
-
|
|
PKC
|
Inflammation/Immunology
|
|
PKCβII Peptide Inhibitor I is a PKCβII inhibitor. PKCβII Peptide Inhibitor I shows cardioprotective effects in rat cardiac Ischemia/reperfusion injury model. PKCβII Peptide Inhibitor I also prevents vascular endothelial dysfunction .
|
-
- HY-P10710
-
|
|
IFNAR
Interleukin Related
COX
|
Inflammation/Immunology
|
|
BMP-4 is a penetrating heparin-binding peptide with anti-inflammatory and anti-chondrogenic functions. In murine chondrocytes and macrophages, BMP-4 regulates the iNOS-IFN-IL6 signaling pathway to inhibit the expression of inflammatory proteins such as iNOS, COX2, IFN, and IL6 in a dose-dependent manner, effectively suppressing inflammation and alleviating various arthritis symptoms .
|
-
- HY-P0017
-
-
- HY-P2289A
-
|
pBD-1 TFA
|
Bacterial
|
Infection
|
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
-
- HY-P5798
-
|
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
-
- HY-108814
-
|
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
-
- HY-108814A
-
|
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
-
- HY-P0254
-
|
|
Kisspeptin Receptor
|
Cardiovascular Disease
Cancer
|
|
Kisspeptin-10, human is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10, human acts as a tumor metastasis suppressor via its receptor GPR54. Kisspeptin-10-GPR54 system plays an important role in embryonic kidney development. Kisspeptin-10/GPR54 signaling induces osteoblast differentiation via NFATc4-mediated BMP2 expression .
|
-
- HY-P1197A
-
|
|
Kisspeptin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Kisspeptin-10 (mouse, rat) TFA is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10 (mouse, rat) TFA is a ligand for the rodent kisspeptin receptor (KISS1, GPR54). Kisspeptin-10 (mouse, rat) TFA reduces Methotrexate-induced reproductive toxicity as a potential antioxidant compound .
|
-
- HY-P4190
-
|
|
GnRH Receptor
|
Endocrinology
|
|
FSH receptor-binding inhibitor fragment(bi-10) is a potent FSH antagonist. FSH receptor-binding inhibitor fragment(bi-10) blocks the binding of FSH to FSHR, and alteres FSH action at the receptor level. FSH receptor-binding inhibitor fragment(bi-10) results in the suppression of ovulation and causes follicular atresia of mice. FSH receptor-binding inhibitor fragment(bi-10) has the potential for utilizing to restrain the carcinogenesis of ovarian cancer by down-regulating overexpression of FSHR and ERβ in the ovaries .
|
-
- HY-P5371
-
|
|
Thrombin
|
Others
|
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
-
- HY-163425S
-
-
- HY-P10256
-
|
|
Kisspeptin Receptor
PKA
PKC
|
Endocrinology
|
|
Kiss2 peptide is a positive regulator of reproduction. Kiss2 peptide binds with its cognate receptor Kiss2R (GPR54) in COS-7 cells, activates PKA and PKC signaling pathways through Gas and Gaq proteins, and thus enhances the activity of cAMP response element-dependent luciferase (CRE-luc) and serum response element-dependent luciferase (SRE-luc) .
|
-
- HY-P10419
-
|
|
Kisspeptin Receptor
GnRH Receptor
|
Endocrinology
|
|
Zebrafish Kisspeptin-1 is the core sequence of the neuropeptide kisspeptin-1, which participate in the regulation of gonadotropin-releasing hormone (GnRH) release, and regulates the reproductive system .
|
-
- HY-P10256A
-
|
|
Kisspeptin Receptor
PKA
PKC
|
Endocrinology
|
|
Kiss2 peptide acetate is the acetate form of Kiss2 pepride (HY-P10256). Kiss2 peptide acetate is a positive regulator of reproduction. Kiss2 peptide acetate binds with its cognate receptor Kiss2R (GPR54) in COS-7 cells, activates PKA and PKC signaling pathways through Gas and Gaq proteins, and thus enhances the activity of cAMP response element-dependent luciferase (CRE-luc) and serum response element-dependent luciferase (SRE-luc) .
|
-
- HY-P1196
-
-
- HY-P1196A
-
-
- HY-P10849
-
|
|
Calcium Channel
|
Others
|
|
IP3RPEP6 is an IP3R competitive inhibitor. IP3RPEP6 has the IC50 values of 9.0 μM, 3.9 μM and 4.3 μM for IP3R1, IP3R2 and IP3R3, respectively. IP3RPEP6 does not affect the Ryanodine receptor and Cx43 hemichannels. IP3RPEP6 regulates calcium signaling within cells .
|
-
- HY-P4062
-
|
BIL
|
Insulin Receptor
|
Metabolic Disease
|
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
-
- HY-P1736
-
|
|
Influenza Virus
|
Infection
|
|
Influenza HA (126-138) is a influenza virus hemagglutinin (HA) peptide comprising amino acids 126-138, induces thymic and peripheral T-cell apoptosis .
|
-
- HY-P10672
-
-
- HY-P1499
-
-
- HY-P1342A
-
|
|
ERK
|
Neurological Disease
|
|
Prosaptide Tx14(A) TFA, a prosaposin-derived peptide, is a potent GPR37L1 and GPR37 agonist with EC50s of 5 and 7 nM, respectively. Prosaptide Tx14(A) TFA increases both ERK1 and ERK2 phosphorylation in Schwann cells .
|
-
- HY-P5595
-
|
|
Bacterial
|
Infection
|
|
Temporin C is an antimicrobial peptide against Legionella pneumophila .
|
-
- HY-P10247
-
|
|
Mitochondrial Metabolism
|
Neurological Disease
|
|
Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .
|
-
- HY-P10245
-
|
|
RSV
|
Inflammation/Immunology
|
|
Fusion glycoprotein 92-106 is a polypeptide from fusion protein of respiratory syncytial virus (RSV). Fusion glycoprotein 92-106 acts as MHC class I-restricted CTL epitope, that all 15 amino acids are required for efficient recognition by cytotoxic T lymphocyte (CTL) .
|
-
- HY-P1442
-
|
|
Adrenergic Receptor
|
Cancer
|
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
-
- HY-P5784
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
-
- HY-P5807
-
|
β-Mammal toxin Cn2
|
Sodium Channel
|
Neurological Disease
|
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
-
- HY-P5807A
-
|
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
-
- HY-P1560
-
|
Lysozyme C (46-61) (chicken)
|
Bacterial
|
Infection
|
|
Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
|
-
- HY-P10658
-
|
|
Phospholipase
|
Others
|
|
ARF1 (2-17) inhibits both ARF-independent (PLC-β) and ARF-dependent (PLD) pathways. ARF1 (2-17) inhibits GTP-γ-S-stimulated PLD activity, phospholipase C-β (PLC-β), and exocytosis .
|
-
- HY-P1401
-
|
|
PKC
|
Metabolic Disease
|
|
Protein Kinase C (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (PKC), with an IC50 of 0.18 μM. Protein Kinase C (19-36) markedly attenuated vascular hyperproliferation and hypertrophy as well as glucose-induced suppression of natriuretic peptide receptor response .
|
-
- HY-P3689
-
|
|
CGRP Receptor
Adenylate Cyclase
|
Others
|
|
[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat is a fragments 22-37 of rat calcitonin gene related peptide (CGRP), targeting CGRP receptor and adenylate cyclase. Calcitonin is mainly produced by thyroid C cells while CGRP is secreted and stored in the nervous system .
|
-
![[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat](//file.medchemexpress.eu/product_pic/hy-p3689.gif)
- HY-156343S1
-
-
- HY-P10815
-
|
|
Apoptosis
Calcium Channel
|
Others
|
|
IP3RCYT is IP3R inhibitory peptide, which can inhibit the binding of cytochrome C to IP3R with an IC50 about 100 nM. IP3RCYT regulates calcium signaling within cells. P3RCYT inhibits apoptosis in HeLa and Jurkat cells treated with Staurosporine (HY-15141) or Membrane-bound Fas ligand (FasL) .
|
-
- HY-P1602
-
|
|
Bacterial
|
Infection
|
|
Apidaecin IB is a insect antimicrobial peptide, with minimum inhibitory concentration (MIC) values of 8 μM for E. coli (ML35, O18K1H7 and ATCC 25922).
|
-
- HY-P5721
-
|
|
Bacterial
|
Infection
|
|
Apidaecin IA is an antibacterial peptide that can be found in honeybees .
|
-
- HY-P2341
-
|
|
LDLR
|
Cancer
|
|
Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
-
- HY-P4095
-
|
|
CXCR
|
Cancer
|
|
NoxaBH3 is a cysteine-based cross-linked peptide with increased cell permeability and higher inhibitory activity against Mcl-1. NoxaBH3 binds to the endogenous CXCR4 ligand to produce ubiquitin-Noxabh3 conjugate. NoxaBH3 is then delivered to cancer cells .
|
-
- HY-P10692
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
HB-107 is a peptide with wound healing properties. HB-107 promotes the proliferation of keratinocytes and increased leukocyte infiltration at the wound site, and it also stimulates cultured endothelial cells to secrete interleukin 8 (IL-8). HB-107 holds potential for research in the fields of wound healing and inflammation .
|
-
- HY-P4156
-
|
|
mAChR
|
Neurological Disease
|
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA .
|
-
- HY-P5911
-
|
|
iGluR
|
Inflammation/Immunology
|
|
GluN1 (359-378) is an anti-N-methyl-D-aspartate
receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier.
GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting
the immune system .
|
-
- HY-P5723
-
|
|
Bacterial
|
Infection
|
|
Api137 is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 inhibits protein synthesis by trapping of release factors on the 70S ribosome following hydrolysis of the nascent polypeptide chain .
|
-
- HY-P5723A
-
|
|
Bacterial
|
Infection
|
|
Api137 TFA is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 TFA inhibits protein synthesis by trapping of release factors on the 70S ribosome following hydrolysis of the nascent polypeptide chain .
|
-
- HY-P10354
-
-
- HY-P1654
-
|
|
Integrin
|
Cancer
|
|
A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from the foot-and-mouth disease virus. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors .
|
-
- HY-P4971
-
|
|
Complement System
|
Inflammation/Immunology
|
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
-
- HY-P2265
-
|
|
Ras
|
Cancer
|
|
SAH-SOS1A is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM), directly and independently blocks nucleotide association, impairs KRAS-driven cancer cell viability, and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
-
- HY-P2265A
-
|
|
Ras
|
Cancer
|
|
SAH-SOS1A TFA is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A TFA binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM). SAH-SOS1A TFA directly and independently blocks nucleotide association. SAH-SOS1A TFA impairs KRAS-driven cancer cell viability and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
-
- HY-P3099
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
-
- HY-P5923
-
|
|
CXCR
|
Inflammation/Immunology
|
|
E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
|
-
- HY-P6010
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP is a selective αvβ6 binding peptide, and can be used for molecular imaging .
|
-
- HY-P10300
-
|
IL-8 (54-72)
|
CXCR
|
Inflammation/Immunology
|
|
CXCL8 (54-72) is a C-terminal peptide based on the chemokine CXCL8. CXCL8 (54-72) has an interaction between a long and highly positively charged C-terminal region and a negative charge on the GAG that binds to the GAG. CXCL8 (54-72) can inhibit the adhesion and migration of neutrophils and adhesion of endothelial cells. CXCL8 (54-72) can be used to study chemokines in inflammatory response .
|
-
- HY-108741A
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-108741
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
-
- HY-P4073
-
|
GRN1005; Paclitaxel trevatide
|
Peptide-Drug Conjugate (PDC)
LDLR
|
Cancer
|
|
ANG1005 (Paclitaxel trevatide) is a brain-penetrating peptide-drug conjugate. ANG1005, a taxane derivative, consists of three paclitaxel (HY-B0015) molecules covalently linked to Angiopep-2, designed to cross the blood-brain and blood-cerebrospinal barriers and to penetrate malignant cells via low density lipoprotein receptor-related protein (LRP1) transport system .
|
-
- HY-P5891
-
|
|
PKC
|
Cardiovascular Disease
|
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
-
- HY-P4690
-
-
- HY-P5627
-
|
|
Bacterial
|
Infection
|
|
XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-4 has strong activity against E.coli, the vaule of MIC is 18 μM .
|
-
- HY-P2791
-
|
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Tertiapin (reduced) is a kind of synthesis of melittin, its Cys3-Cys14 and Cys5-Cys18 between containing a disulfide bond. Tertiapin (reduced) is a kind of inward rectifier potassium channels blockers, can block the activity of calcium activates large conductance potassium channels. Tertiapin (reduced) can be used for research in diseases such as rheumatoid arthritis and multiple sclerosis .
|
-
- HY-P1987
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Mast cell degranulating peptide (28-49) is a depolarizing agent from bee venom, it can raise the content of cGMP level in mouse cerebellar slices .
|
-
- HY-P1783A
-
|
|
Influenza Virus
|
Infection
|
|
M2e, human TFA, consisting of the 23 extracellular residues of M2 (the third integral membrane protein of influenza A), has been remarkably conserved in all human influenza A. M2e, human TFA is a valid and versatile vaccine candidate to protect against any strain of human influenza A .
|
-
- HY-P2358
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
|
-
- HY-P5961
-
-
- HY-P6009
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P6010A
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP TFA is a selective αvβ6 binding peptide, and can be used for research of molecular imaging .
|
-
- HY-P10574
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
Phosphorylated CHKtide is a synthetic peptide substrate derived from CDC25C, which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. Phosphorylated CHKtide is used in the assays of cell cycle checkpoint kinases 1 and 2 (CHK1/CHK2) and salt-inducible kinases (SIKs) .
|
-
- HY-P10587
-
|
JNJ-77242113; JNJ-2113; PN-235
|
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Icotrokinra (JNJ-77242113) is an orally available, selective antagonist of the IL-23 receptor. Icotrokinra inhibits IL-23-induced STAT3 phosphorylation in peripheral blood mononuclear cells (IC50=5.6 pM) and inhibits IL-23-induced interferon IFN-γ production in NK cells with an IC50 of 18.4 pM. In addition, Icotrokinra exhibits anti-inflammatory activity in a rat TNBS-induced colitis model. Icotrokinra can be used in the study of psoriasis, psoriatic arthritis, and inflammatory bowel disease .
|
-
- HY-P10821
-
|
|
PKC
Reactive Oxygen Species
|
Cardiovascular Disease
|
|
Myr-Tat-PKCβII is a cell permeable protein kinase C β II peptide inhibitor. Myr-Tat-PKCβII mitigates the generation of reactive oxygen species in rat ex-vivo and porcine in-vivo ischemia-reperfusion injury .
|
-
- HY-P1238A
-
|
Neuromedin U (rat) TFA; Rat neuromedin U-23 TFA
|
Neuromedin U Receptor
|
Neurological Disease
|
|
Neuromedin U, rat TFA is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception.
|
-
- HY-P10250
-
|
|
HIV
|
Inflammation/Immunology
|
|
HIV gp120 308-331 is HIV antigen fragments, that conjugates with keyhole limpet hemocyanin (KLH) and generates specific anti-HIV antibody .
|
-
- HY-P1190
-
|
|
JNK
Apoptosis
|
Inflammation/Immunology
|
|
c-JUN peptide is a cell-permeable c-JUN-JNK interaction inhibitor. c-JUN peptide inhibits serum-induced c-Jun phosphorylation. c-JUN peptide induces apoptosis .
|
-
- HY-P5690
-
|
|
Bacterial
|
Infection
|
|
Distinctin is an antimicrobial peptide. Distinctin can be isolated from frog skin. Distinctin has antibacterial activity against E. faecalis, P. aeruginosa, S. aureus and E. coli (MIC: 14.5, 28.0, 28.0, 14.5 μM) .
|
-
- HY-P6009A
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP TFA is a cysteine-terminated αvβ6 binding peptide .
|
-
- HY-P2285
-
-
- HY-P3517
-
|
β-EP (6-31), human
|
Opioid Receptor
|
Neurological Disease
Endocrinology
|
|
β-Endorphin, an endogenous opioid neuropeptide, is an opioid receptor agonist. β-Endorphin binds preferentially to μ-opioid receptors and is produced in certain neurons of the central and peripheral nervous system and is one of three endorphins produced in humans. β-Endorphin can be used to reduce stress and maintain homeostasis in the body and is involved in neurological pain perception regulation .
|
-
- HY-P5158
-
|
|
Adrenergic Receptor
|
Others
|
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
-
- HY-P5887
-
-
- HY-P5746
-
|
|
ADC Cytotoxin
Antibiotic
|
Others
|
|
Suicin 65 is a class I type B lantibiotic produced by Streptococcus suis. Suicin 65 is active against all S. suis isolates .
|
-
- HY-P5054
-
-
- HY-P10101
-
|
APTscr
|
STAT
|
Others
|
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
-
- HY-P1393
-
|
|
Amylin Receptor
|
Endocrinology
|
|
AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has neuroprotective effects .
|
-
- HY-P1393A
-
|
|
Amylin Receptor
|
Endocrinology
|
|
AC 187 TFA is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 TFA shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 TFA has neuroprotective effects .
|
-
- HY-P1403
-
|
|
Potassium Channel
|
Others
|
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
-
- HY-P5892
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin (1-27) (human) is an opioid antagonist that binds μ-, δ-, and κ-opioid receptors with Kis of 5.31, 6.17, and 39.82 nM, respectively. β-Endorphin (1-27) (human) inhibits β-Endorphin (HY-P1502)-induced and etorphine-induced analgesia .
|
-
- HY-P5736
-
|
|
Bacterial
|
Infection
|
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
-
- HY-P5550
-
|
|
Influenza Virus
|
Infection
|
|
Urumin has antiviral activity against the human influenza A virus. Urumin inhibits the growth of PR8 influenza virus (IC50: 3.8 μM). Urumin targets the conserved stalk of H1 hemagglutini, and is effective at neutralizing drug-resistant H1 influenza viruses. Urumin protects naive mice from lethal influenza infection .
|
-
- HY-P1275
-
-
- HY-P1135
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
M1145, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 has an additive effect on the signal transduction of galanin .
|
-
- HY-P1135A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
M1145 TFA, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 TFA shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 TFA has an additive effect on the signal transduction of galanin .
|
-
- HY-P5588
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5686
-
|
|
Bacterial
|
Infection
|
|
Maximin 78 is an antimicrobial peptide. Maximin 78 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 37.5, 4.7, 37.5 μg/mL). Maximin 78 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P10200
-
|
|
Bacterial
|
Infection
|
|
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .
|
-
- HY-159192S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
SADDNIKTPAE(Arg- 13C6, 15N4)LLGPLPPSADDNLKT (TFA) is the 13C and 15N labeled isotope of SADDNIKTPAE-LLGPLPPSADDNLKT (TFA) .
|
-
- HY-P10719
-
|
|
MyD88
|
Infection
Inflammation/Immunology
|
|
Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. It holds potential for studying the role of MyD88 in viral infections .
|
-
- HY-12537
-
-
- HY-P1349
-
-
- HY-P1015
-
|
Vasoactive Intestinal Peptide, guinea pig
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
|
VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
-
- HY-P1015A
-
|
Vasoactive Intestinal Peptide, guinea pig TFA
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
|
VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
-
- HY-P4129
-
|
|
nAChR
|
Others
|
|
Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide. Rabies Virus Matrix Protein Fragment targets the acetylcholine receptor (AChR) that exists on the cell surface .
|
-
- HY-P10356
-
|
|
TRP Channel
|
Others
|
|
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .
|
-
- HY-P1132
-
-
- HY-P1132A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect .
|
-
- HY-P2426
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) is a potent and competitive antagonist of parathyroid hormone (PTH), with a Ki of 69 nM in bovine renal cortical membrane. (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) can be used for growth and development regulation .
|
-
- HY-P1285
-
|
Con-R
|
iGluR
|
Neurological Disease
|
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
-
- HY-P4927
-
-
- HY-P5724
-
|
|
Bacterial
|
Infection
|
|
Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality .
|
-
- HY-P1128
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively .
|
-
- HY-P1128A
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively .
|
-
- HY-P0209
-
-
- HY-P1502
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
-
- HY-P1866
-
-
- HY-P1866A
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .
|
-
- HY-P2260
-
|
|
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
-
- HY-P1728
-
|
|
YAP
|
Cancer
|
|
Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model .
|
-
- HY-P3141
-
-
- HY-P4817
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
Human PTH-(1-31) is the 1-31 fragment of human PTH. Human PTH-(1-31) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. Human PTH-(1-31) induces bone formation without inducing bone resorption. Human PTH-(1-31) has the potential for the research of osteoporosis .
|
-
- HY-P2260B
-
|
|
HIV
|
Infection
|
|
Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
-
- HY-P2260C
-
|
|
HIV
|
Infection
|
|
Tat-beclin 1 scrambled TFA is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
-
- HY-P2046
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction .
|
-
- HY-P4924
-
-
- HY-P10408
-
|
|
EGFR
MMP
Calcium Channel
|
Infection
Inflammation/Immunology
|
|
Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and avirulent characters. Candidalysin activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) of host cells, activates matrix metalloproteinase (MMP) and calcium flux, resulting in inflammatory responses and recruitment of immune cells. Candidalysin exhibits cytotoxicity by dealing membran damage to host cells .
|
-
- HY-P1106
-
|
|
CRFR
|
Cardiovascular Disease
|
|
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 can be used for hypotension study .
|
-
- HY-P1106A
-
|
|
CFTR
|
Cardiovascular Disease
|
|
K41498 TFA is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 TFA is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 TFA can be used for hypotension study .
|
-
- HY-P1107
-
|
aSvg-30
|
CRFR
|
Neurological Disease
|
|
Antisauvagine-30 (aSvg-30) is a potent, competitive and selective CRF2 receptor antagonist with Kd values of 1.4 nM and 153.6 nM for mouse CRF2β and rat CRF1 receptors, respectively .
|
-
- HY-P1160A
-
|
|
GCGR
|
Metabolic Disease
|
|
Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes .
|
-
- HY-P1160
-
|
|
GCGR
|
Metabolic Disease
|
|
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes .
|
-
- HY-P4818
-
-
- HY-P5272
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Histatin-3 TFA, a 32 amino acid peptide, possesses powerful antimicrobial properties. Histatin-3 TFA behaves as a substrate for proprotein convertase 1 (PC1), being cleaved by this endoprotease primarily at a site carboxy terminal to the single Arg25 residue (HRGYR decrease SN). Histatin-3 TFA is a moderately potent, reversible and competitive inhibitor of the furin-mediated cleavage of the pentapeptide pGlu-Arg-Thr-Lys-Arg-MCA fluorogenic substrate, with an estimated inhibition constant Ki of 1.98 μM .
|
-
- HY-P1502F
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Biocytin-β-endorphin, human is abiotinylated β-Endorphin, human (HY-P1502). β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
-
- HY-P4696
-
-
- HY-P4700
-
-
- HY-P10110
-
|
|
Autophagy
|
Neurological Disease
|
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
-
- HY-P10108
-
|
Hxk2VBD peptide, cell-permeable
|
Hexokinase
|
Neurological Disease
|
|
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth .
|
-
- HY-P2279
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
Endocrinology
|
|
Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis .
|
-
- HY-P2279A
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
Endocrinology
|
|
Parathyroid hormone (1-34) (rat) (acetate) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis .
|
-
- HY-P5443
-
|
|
Bacterial
|
Others
|
|
Pyrrhocoricin is a biological active peptide. (Antimicrobial activity against Gram-negative bacteria)
|
-
- HY-P5714
-
|
|
Bacterial
|
Infection
|
|
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain .
|
-
- HY-P2543
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor .
|
-
- HY-P10000
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion .
|
-
- HY-P0092
-
-
- HY-P1601
-
-
- HY-P2273
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
-
- HY-P2250
-
|
ELA-32 negative control
|
Apelin Receptor (APJ)
|
Others
|
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
-
- HY-P2196A
-
|
|
Apelin Receptor (APJ)
|
Cancer
|
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
-
- HY-P2196
-
-
- HY-P10290
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Neuropeptide Y (human) free acid upregulates the adhesiveness of human endothelial cells for leukocytes. Neuropeptide Y belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response .
|
-
- HY-P10696
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
C16G2 is a specific targeted antimicrobial peptide (STAMP) that targets the cariogenic oral pathogen Streptococcus mutans. C16G2 specifically recognizes and disrupts the bacterial cell membrane, causing small molecule leakage and loss of membrane potential, leading to bacterial killing. Unlike broad-spectrum antimicrobial peptides, C16G2 exhibits higher selectivity and efficacy against Streptococcus mutans .
|
-
- HY-P10768
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
Ro 25-1553 is a 31 amino acid vasoactive intestinal peptide (VIP) analog, that acts as an agonist for VIP2 receptor (VPAC2 receptor). Ro 25-1553 exhibits a bronchodilator effect in nerve-induced or Carbachol (HY-B1208)-induced tracheal smooth muscle contraction in guinea pig model .
|
-
- HY-P10842
-
|
|
GLP Receptor
Akt
|
Metabolic Disease
Inflammation/Immunology
|
|
d-GLP-2 E33A is an agonist for the glucagon-like peptide 2 receptor (GLP-2R) with an EC50 of 414 nM. d-GLP-2 E33A can activate GLP-2R and increase the phosphorylation of AKT, but has no stimulative effect on GLP-1R. d-GLP-2 E33A can be used in the study of diseases such as intestinal malabsorption and inflammatory bowel diseases .
|
-
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
-
- HY-P0198
-
-
- HY-P0199
-
-
- HY-P1514
-
-
- HY-P1537
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
Endocrinology
|
|
Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4.
|
-
- HY-P0198A
-
-
- HY-P0212
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
-
- HY-P0212A
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
-
- HY-P1323
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) can increase blood pressure in anesthetized rats and increases food intake .
|
-
![[Leu31,Pro34]-Neuropeptide Y (human,rat)](//file.medchemexpress.eu/product_pic/hy-p1323.gif)
- HY-P1323A
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) TFA is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA can increase blood pressure in anesthetized rats and increases food intake .
|
-
![[Leu31,Pro34]-Neuropeptide Y(human,rat,mouse) TFA](//file.medchemexpress.eu/product_pic/hy-p1323a.gif)
- HY-P0208
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
[Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects .
|
-
![[Leu31,Pro34]-Neuropeptide Y (porcine)](//file.medchemexpress.eu/product_pic/hy-p0208.gif)
- HY-P3877
-
-
- HY-P4060
-
-
- HY-P5203
-
|
EntK1
|
Bacterial
|
Infection
|
|
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections .
|
-
- HY-P5204
-
|
K1-EJ hybrid
|
Bacterial
|
Infection
|
|
Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus .
|
-
- HY-P5662
-
|
|
Bacterial
|
Infection
|
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P3877A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM .
|
-
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
-
- HY-P10265
-
|
|
Melanocortin Receptor
|
Others
|
|
Melanostatin, frog is an inhibitor for α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM .
|
-
- HY-P10291
-
-
![[Pro34]Neuropeptide Y, porcine](//file.medchemexpress.eu/product_pic/hy-p10291.gif)
- HY-P10545
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
[D-His26]-Neuropeptide Y, human, rat is a synthetic variant of neuropeptide Y (NPY). [D-His26]-Neuropeptide Y, human, rat acts as a Y1R agonist that can prevent the development of anxiety, social impairment, and depressive symptoms, and has the potential to be used as an early intervention treatment for post-traumatic stress reactions .
|
-
![[D-His26]-Neuropeptide Y, human, rat](//file.medchemexpress.eu/product_pic/hy-p10545.gif)
- HY-P10517
-
|
SFT
|
HIV
|
Infection
|
|
Sifuvirtide (SFT) is a potent HIV fusion inhibitor. Sifuvirtide inhibits HIV-1 mediated cell fusion in a dose-dependent manner and is highly potent against infection by primary and laboratory-adapted HIV-1 isolates of multiple genotypes. Sifuvirtide can be used in the research of anti-HIV drugs .
|
-
- HY-P4060A
-
-
- HY-P0198B
-
-
![[D-Arg25]-Neuropeptide Y (human)](//file.medchemexpress.eu/product_pic/hy-p0198b.gif)
- HY-P5277
-
|
|
DAPK
|
Neurological Disease
|
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
-
- HY-P5114
-
|
|
Calcium Channel
|
Others
|
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P5498
-
|
|
HIV
|
Others
|
|
N36 peptide is a biological active peptide. (HIV-1 gp41 fusion peptide)
|
-
- HY-P3037
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P5319
-
|
|
Others
Calcium Channel
|
Others
|
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
-
- HY-P3037A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Imperatoxin A TFA is a peptide toxin derived from the venom of the African scorpion Pandinus imperator. Imperatoxin A TFA is a Ca 2+-release channels/ryanodine receptors (RyRs) activator. Imperatoxin A TFA enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
-
- HY-P5114A
-
|
|
Calcium Channel
|
Others
|
|
Maurocalcine TFA is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine TFA induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine TFA exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine TFA can be applied to in vivo cell tracking or other cell imaging techniques .
|
-
- HY-P0090S
-
|
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
- HY-P1477
-
-
- HY-P1477A
-
-
- HY-P2847
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow .
|
-
- HY-P3365
-
|
|
Bacterial
|
Inflammation/Immunology
Cancer
|
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory .
|
-
- HY-P5363
-
|
Prostatic Acid Phosphatase(248-286)
|
HIV
|
Others
|
|
PAP 248–286 is a biological active peptide. (Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.)
|
-
- HY-P5810
-
|
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
-
- HY-P5811
-
|
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
-
- HY-P5649
-
|
|
Bacterial
|
Infection
|
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
-
- HY-P5914
-
|
WaTx
|
TRP Channel
|
Neurological Disease
|
|
Wasabi Receptor Toxin is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
-
- HY-P10141
-
|
|
JNK
|
Cancer
|
|
JNK-IN-15, Cell-Permeable, Negative Control is a negative control of JNK-IN-15, Cell-Permeable (HY-P10140). JNK-IN-15, Cell-Permeable is an inhibitor of JNK .
|
-
- HY-P10140
-
|
|
JNK
|
Cancer
|
|
JNK-IN-15, Cell-Permeable (JNK inhibitor III) is an inhibitor of JNK. JNK-IN-15, Cell-Permeable can used in study age-related neurodegenerative diseasev .
|
-
- HY-P5914A
-
|
WaTx TFA
|
TRP Channel
|
Neurological Disease
|
|
Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin (HY-P5914). Wasabi Receptor Toxin TFA is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin TFA is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin TFA causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
-
- HY-P1295
-
|
Urocortin (human); Human urocortin; Human urocortin 1; Human urocortin I
|
CRFR
|
Neurological Disease
Endocrinology
|
|
Urocortin, human, a 40-aa neuropeptide, acts as a selective agonist of endogenous CRF2 receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively.
|
-
- HY-P1298
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1220
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1220A
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
-
- HY-P1440A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
-
- HY-P1440
-
-
- HY-P1681
-
-
- HY-P5788
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
-
- HY-P5790
-
|
|
Sodium Channel
|
Neurological Disease
|
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
-
- HY-P5793
-
-
- HY-P5943
-
-
- HY-P5179
-
|
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
-
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
-
- HY-P0203B
-
-
- HY-P10716
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin-P5 is a selective agonist that targets the GLP-1R. Exendin-P5 promotes rapid activation of G proteins by transient interactions with the transmembrane domain of GLP-1R, enhancing its potency in G protein-mediated signaling and accelerating cAMP production. This mechanism suggests the potential application of Exendin-P5 in the study of metabolic diseases .
|
-
- HY-P1533
-
-
- HY-P1533A
-
-
- HY-P1298A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
-
- HY-P1282
-
-
- HY-P3503
-
|
BMN 111
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
-
- HY-P3503A
-
|
BMN 111 acetate
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
-
- HY-P5127
-
-
- HY-P5868
-
|
|
Sodium Channel
|
Neurological Disease
|
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
-
- HY-P5870
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
-
- HY-P5900
-
|
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
-
- HY-P1434
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
[Pro3]-GIP (mouse) is a GIP receptor antagonist (IC50: 2.6 μM). [Pro3]-GIP (mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (mouse) can be used for research of type 2 diabetes .
|
-
![[Pro3]-GIP (mouse)](//file.medchemexpress.eu/product_pic/hy-p1434.gif)
- HY-P5180
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
-
- HY-P5631
-
|
|
Bacterial
|
Infection
|
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
-
- HY-P5632
-
|
|
Bacterial
|
Infection
|
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
-
- HY-P5916
-
|
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Others
Potassium Channel
|
Neurological Disease
|
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
-
- HY-P10337
-
|
|
GCGR
GLP Receptor
|
Metabolic Disease
Endocrinology
|
|
OXM-7 is a dual agonist of GLP-1R (EC50=0.024 nM) and GCGR (EC50=0.082 nM). OXM-7 can enhance glucose-stimulated insulin secretion and hepatic glucose output. OXM-7 lowers blood glucose levels. OXM-7 improves lipid metabolism .
|
-
- HY-P10735
-
|
Gastric inhibitory polypeptide(mouse); GIP(1-42) (mouse)
|
Insulin Receptor
|
Endocrinology
|
|
GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insulin secretion .
|
-
- HY-P0089
-
|
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
-
- HY-P1280
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P0089A
-
|
Growth Hormone Releasing Factor human TFA; Somatorelin (1-44) amide (human) (TFA)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
-
- HY-P1281
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
-
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P1426
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P5165
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
-
- HY-P1280A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
-
- HY-P5853
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
-
- HY-P1108
-
|
|
CFTR
|
Others
|
|
Astressin 2B is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B antagonizes CRF2-mediated inhibition of gastric emptying .
|
-
- HY-P5931
-
|
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
-
- HY-P5182
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P1108A
-
|
|
CFTR
|
Others
|
|
Astressin 2B TFA is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B TFA antagonizes CRF2-mediated inhibition of gastric emptying .
|
-
- HY-P5182A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
-
- HY-P10721
-
|
|
Antibiotic
Bacterial
|
Infection
|
Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice .
|
-
- HY-P1409A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
-
- HY-P1805
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
-
- HY-P4157
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-P4157A
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells .
|
-
- HY-P1330
-
|
|
P2X Receptor
|
Inflammation/Immunology
|
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
-
- HY-P5710
-
|
|
Bacterial
|
Infection
|
|
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo .
|
-
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
-
- HY-P1426A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
-
- HY-P10078
-
-
- HY-P4127A
-
-
- HY-P1727
-
|
|
YAP
|
Cancer
|
|
Super-TDU is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU suppresses tumor growth in gastric cancer mouse model .
|
-
- HY-P5818
-
-
- HY-P5920
-
-
- HY-P5156
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
-
- HY-P5824
-
-
- HY-P1534
-
-
- HY-P1079
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
-
- HY-P1604
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
-
- HY-P1604A
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
-
- HY-P4898
-
|
|
Sodium Channel
|
Cardiovascular Disease
|
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
-
- HY-P4898A
-
|
|
Sodium Channel
|
Cardiovascular Disease
|
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
-
- HY-P10720
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP .
|
-
- HY-P1815
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P1815A
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
-
- HY-P3089
-
|
|
Potassium Channel
|
Others
|
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P3089A
-
|
|
Potassium Channel
|
Others
|
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
-
- HY-P5065
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
-
- HY-P2291
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
-
- HY-P2291A
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
-
- HY-108719
-
-
- HY-106216
-
|
|
Elastase
|
Infection
Inflammation/Immunology
|
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
-
- HY-P5796
-
|
|
Calcium Channel
|
Neurological Disease
|
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
-
- HY-P5835
-
|
|
Potassium Channel
|
Neurological Disease
|
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
-
- HY-P3269
-
|
|
Calcium Channel
|
Others
|
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
-
- HY-P5459
-
|
|
Bacterial
Elastase
|
Infection
|
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
-
- HY-P3065
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
-
- HY-P5152
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
-
- HY-P1264
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
-
- HY-P1264F1
-
|
|
nAChR
|
Neurological Disease
|
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P1264F
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
-
- HY-P5695
-
|
|
Bacterial
|
Infection
|
|
GP-2B is an antimicrobial peptide. GP-2B shows antibacterial activity against Gram-positive strain (MIC: 8-128 μg/mL for S. aureus and Enterococcus faecalis) .
|
-
- HY-P5359
-
-
- HY-P4427
-
|
|
Fluorescent Dye
|
Others
|
|
Z-VAN-AMC is a fluorogenic substrate. Z-VAN-AMC can be hydrolysed by a phytophagous mite of legumain-like activity .
|
-
- HY-P0078
-
TRAP-6
4 Publications Verification
PAR-1 agonist peptide; Thrombin Receptor Activator Peptide 6
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
TRAP-6 (PAR-1 agonist peptide), a peptide fragment, is a selective protease activating receptor 1 (PAR1) agonist. TRAP-6 activates human platelets via the thrombin receptor. TRAP-6 shows no activity at PAR4 .
|
-
- HY-P1740
-
|
|
Integrin
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
RGD peptide (GRGDNP) is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) plays an important role in cell adhesion, migration, growth, and differentiation .
|
-
- HY-P1740A
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
RGD peptide (GRGDNP) TFA is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) TFA competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) TFA promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) TFA plays an important role in cell adhesion, migration, growth, and differentiation .
|
-
- HY-P2518
-
|
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
Protease-Activated Receptor-1, PAR-1 Agonist is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
-
- HY-P2518A
-
|
|
Protease Activated Receptor (PAR)
|
Cancer
|
|
Protease-Activated Receptor-1, PAR-1 Agonist TFA is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist TFA corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
-
- HY-P4279
-
-
- HY-P10549
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
NGFFFamide is a muscle-active neuropeptide found in sea urchins. NGFFFamide regulates muscle activity by directly interacting with receptor proteins on muscle cells, or indirectly by stimulating nerves or other cell types to release muscle-active factors. NGFFFamide can be used to study muscle contraction and relaxation .
|
-
- HY-P10831
-
|
|
VEGFR
|
Cardiovascular Disease
Cancer
|
|
GNQWFI, an anti-Flt1 peptide, is a VEGFR1-specific antagonist. GNQWFI blocks the interaction of VEGFR1 with various VEGFR1 ligands, such as VEGFA, VEGFB, and placental growth factor (PIGF) and inhibits VEGF-induced endothelial cell migration and tube formation. GNQWFI is promising for research of anti-angiogenic therapeutics for the treatment of cancer, asthma, and other ocular diseases .
|
-
- HY-P5001
-
-
- HY-P5357
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
SFNGGP-NH2 is a biological active peptide. (PAR-3 is a high-affinity thrombin receptor. PAR-3 mRNA is expressed in the cutaneous mast cells of humans. Protease-Activated Receptors (PARs) have been studied for their roles in itch and their itch-associated response through histamine-dependent/independent pathways have been reported. PAR-3 has been shown not to induce itching alone but possibly in conjunction with PAR-4. Co-expression of PAR-3 and PAR-4 enhances thrombin action suggesting that PAR-3 alone does not mediate transmembrane signaling but instead functions as a cofactor to activate PAR-4.)
|
-
- HY-P5358
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
YFLLRNP is a biological active peptide. (a partial agonist of PAR-1. YFLLRNP selectively active G12/13 signaling pathway without activating Gq or Gi pathways at low concentrations. YFLLRNP (60 μM))
|
-
- HY-P5360
-
-
- HY-P4987
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
|
|
TRAP-7 is a thrombin receptor (PAR) activating peptide. TRAP-7 stimulates total inositol phosphate (IP) accumulation and phosphorylation of a specific endogenous substrate for activated PKC. TRAP-7 can be used in cardiovascular disease research .
|
-
- HY-P10293
-
|
|
Thrombin
Others
|
Others
|
|
NQEQVSP, a fibrin-binding protein-derived peptide (FBP), is a factor XIIIa substrate. NQEQVSP can be recognized by factor XIII and is enzymatically conjugated into fibrin during polymerization .
|
-
- HY-P3119
-
|
Desotamide A
|
Bacterial
|
Infection
|
|
Desotamide is a cyclic hexapeptide antibiotic originally isolated from Streptomyces. It is active against S. aureus, S. pneumoniae, and methicillin-resistant S. epidermidis (MRSE; MICs=16, 12.5, and 32 μg/mL, respectively).
|
-
- HY-P0272
-
|
|
HIV
|
Infection
|
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-P1452A
-
|
|
Bacterial
|
Infection
|
|
RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
|
-
- HY-P0272A
-
|
|
HIV
|
Infection
|
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
-
- HY-P1707A
-
|
|
Tau Protein
|
Neurological Disease
|
|
Tau protein (592-597), human TFA is a peptide fragment of human Tau protein. The dysfunction of Tau protein is involved in neurodegeneration and dementia .
|
-
- HY-P2319
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
-
- HY-P2319A
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide TFA, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
-
- HY-P1716
-
|
|
PKC
|
Neurological Disease
|
|
Neuropeptide DF2 is a DRNFLRFamide neuropeptide orignally isolated from crayfish. which enhances transmitter release and stimulates the amplitude of excitatory post-synaptic potentials (EPSP) through the calcium/calmodulin-dependent protein kinase .
|
-
- HY-P10390
-
|
|
Parasite
|
Infection
|
|
Insecticidal agent 11 (compound Q6) is a potent insect growth regulator (IGR)-based insecticide. Insecticidal agent 11 shows high insecticidal activity against Diploptera punctata by inhibiting juvenile hormone (JH) biosynthesis. Insecticidal agent 11 also exhibits insecticidal activity against Plutella xylostella .
|
-
- HY-P0323
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
-
- HY-P1034
-
DAPTA
2 Publications Verification
D-Ala-peptide T-amide; Adaptavir
|
CCR
HIV
|
Infection
Endocrinology
|
|
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
|
-
- HY-P1569
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-P1571
-
|
NP 396
|
Arenavirus
|
Inflammation/Immunology
|
|
Nucleoprotein (396-404) is the 396 to 404 fragment of lymphocytic choriomeningitis virus (LCMV). Nucleoprotein (396-404) is the H-2D(b)-restricted immunodominant epitope and can be used as a molecular model of viral antigen .
|
-
- HY-P1757
-
|
|
HIV
|
Infection
|
|
HIV p17 Gag (77-85) is an HLA-A*0201(A2)-restricted CTL epitope, used in the research of anti-HIV .
|
-
- HY-P1780
-
|
|
CMV
|
Infection
|
|
CEF20 is an HLA-A*0201-restricted epitope from cytomegalovirus pp65 (495-503).
|
-
- HY-P1845
-
|
|
ERK
EGFR
Reactive Oxygen Species
Calcium Channel
|
Neurological Disease
|
|
PACAP-38 (31-38), human, mouse, rat is a PAC1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat elevates cytosolic Ca 2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat can be used for neurotrophic and neuroprotective research .
|
-
- HY-P1907
-
|
|
HPV
|
Cancer
|
|
Human Papillomavirus (HPV) E7 protein (49-57) is the H-2 d-restricted human papillomavirus (HPV) E749-57 epitope (short peptide spanning the 49th to 57th amino acid residues in the E7 protein) .
|
-
- HY-P1569A
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
-
- HY-P1845A
-
|
|
ERK
EGFR
Reactive Oxygen Species
Calcium Channel
|
Neurological Disease
|
|
PACAP-38 (31-38), human, mouse, rat TFA is a PAC1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat TFA elevates cytosolic Ca 2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat TFA can be used for neurotrophic and neuroprotective research .
|
-
- HY-P1571A
-
|
NP 396 TFA
|
Arenavirus
|
Inflammation/Immunology
|
|
Nucleoprotein (396-404) TFA is the 396 to 404 fragment of lymphocytic choriomeningitis virus (LCMV). Nucleoprotein (396-404) TFA is the H-2D(b)-restricted immunodominant epitope and can be used as a molecular model of viral antigen .
|
-
- HY-P1090
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin(rat) is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin(rat) is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin(rat) exerts antinociceptive action in inflammatory pain models .
|
-
- HY-P1090A
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin(rat) TFA is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin(rat) TFA is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin(rat) TFA exerts antinociceptive action in inflammatory pain models .
|
-
- HY-P1091
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin exerts antinociceptive action in inflammatory pain models .
|
-
- HY-P1091A
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin TFA is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin TFA is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin TFA exerts antinociceptive action in inflammatory pain models .
|
-
- HY-P2455
-
|
Listeriolysin O (91-99)
|
Bacterial
|
Inflammation/Immunology
|
|
LLO (91-99) (Listeriolysin O (91-99)), an exotoxin, is a class I MHC-restricted T-cell epitopes of listeriolysin (LLO). LLO (91-99) is an essential antigen for induction of T-cell mediated immunity in vivo .
|
-
- HY-P5449
-
-
- HY-P5487
-
|
|
iGluR
|
Others
|
|
GluR23Y is a biological active peptide. (This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.)
|
-
- HY-P5489
-
|
|
Phosphatase
|
Others
|
|
IGRP(206-214) is a biological active peptide. (This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.)
|
-
- HY-P5745
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
TYVPANASL is a MHC I-binding CD8 T cell epitope of nine amino acids from HER2/neu. TYVPANASL can be used to prepare J-LEAPS vaccine .
|
-
- HY-P5881
-
|
|
PKC
|
Cardiovascular Disease
|
|
PKCα (C2-4) inhibitor peptide is a PKCα specific inhibitor peptide that blocks the inhibition of IKr by the α1A adrenoreceptor agonist A-61603 (HY-101366) .
|
-
- HY-P3206
-
|
Thymulin; Thymic factor
|
ERK
|
Neurological Disease
Inflammation/Immunology
Endocrinology
|
|
Serum thymic factor (Thymulin) is a zinc-dependent immunomodulatory peptide hormone, which can be produced by the thymic epithelial cells. Serum thymic factor stimulates the release of hormones from the pituitary gland, exhibits hypophysiotropic activity. Serum thymic factor protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor exhibits anti-diabetic, anti-inflammatory and analgesic effects. Serum thymic factor can be used in research about endocrine, reproductive, neurodegenerative and inflammatory diseases .
|
-
- HY-P10077
-
-
- HY-P2606
-
-
- HY-P10295
-
|
|
MDM-2/p53
|
Cancer
|
|
p53 (232-240) is a peptide segment of the 232-240 amino acid sequence of the human tumor suppressor protein p53. p53 (232-240) enhances its binding affinity to the Major histocompatibility complex (MHC), thereby enhancing the immunogenicity of this peptide to enhance the immune system's response to tumor antigens. p53 (232-240) can be used in the development of cancer vaccines and in the study of tumor cell recognition and clearance by the immune system .
|
-
- HY-P10433
-
|
|
Apoptosis
|
Cancer
|
|
EGFRvIII peptide is an EGFRvIII-derived epitope for binding to MHC I molecules. EGFRvIII peptide induces apoptosis, and causes specific immune responses against glioblastoma, especially in combination with Flagellin B .
|
-
- HY-P3206A
-
|
Thymulin acetate; Thymic factor acetate
|
ERK
|
Neurological Disease
Inflammation/Immunology
Endocrinology
|
|
Serum thymic factor acetate (Thymulin acetate) is the acetate salt form of Serum thymic factor (HY-P3206). Serum thymic factor acetate is a zinc-dependent immunomodulatory peptide hormone, which can be produced by the thymic epithelial cells. Serum thymic factor acetate stimulates the release of hormones from the pituitary gland, exhibits hypophysiotropic activity. Serum thymic factor acetate protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor acetate exhibits anti-diabetic, anti-inflammatory and analgesic effects. Serum thymic factor acetate can be used in research about endocrine, reproductive, neurodegenerative and inflammatory diseases .
|
-
- HY-P10607
-
|
|
EBV
|
Cancer
|
|
IALYLQQNW is a specific nonapeptide sequence derived from the tumor-associated antigen latent membrane protein 1 (LMP1) encoded by Epstein-Barr virus (EBV). As a latent T-cell epitope, IALYLQQNW is able to activate EBV-specific cytotoxic T lymphocytes (CTLs), which are able to recognize and kill EBV-infected cells expressing LMP1. IALYLQQNW plays an important role in the immune response against EBV-associated tumors and can be used in the study of Hodgkin's disease and nasopharyngeal carcinoma .
|
-
- HY-P10610
-
|
|
MDM-2/p53
|
Cancer
|
|
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
|
-
- HY-P10799
-
-
- HY-P0245
-
-
- HY-P1495
-
-
- HY-P1580
-
|
|
Influenza Virus
|
Infection
|
|
PA (224-233), Influenza is a 10-aa peptide, a fragment of polymerase 2 protein in influenza A virus.
|
-
- HY-P1083A
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors .
|
-
- HY-P1083
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide blocks the dopamine D3 effect on GABAA receptors .
|
-
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
-
- HY-P4820A
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
SYNV-cyclo(CGGYF) TFA is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) TFA inhibits S. aureus activity. SYNV-cyclo(CGGYF) TFA has the potential for the research of S. aureus-mediated epithelial damage and inflammation .
|
-
- HY-P4820
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
SYNV-cyclo(CGGYF) is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) inhibits S. aureus activity. SYNV-cyclo(CGGYF) has the potential for the research of S. aureus-mediated epithelial damage and inflammation .
|
-
- HY-P5452
-
|
|
PKC
|
Others
|
|
PKCd (8-17) is a biological active peptide. (This peptide is derived from the V1 domain of protein kinase C (PKC)d. It inhibits phorbol 12-myristate 13-acetate (PMA)-induced PKCd translocation and activation. Inhibition of PKCd reduces ischemia damage in cardiac and cerebral cells, induces proliferation of fibroblasts, and inhibits graft coronary artery disease in mice.)
|
-
- HY-P2714
-
-
- HY-P10098
-
|
|
PKA
|
Cancer
|
|
PKA Substrate is a potent and selective substrate peptide of PKA that can be used to detect PKA activity .
|
-
- HY-P10430
-
|
|
Transmembrane Glycoprotein
|
Neurological Disease
|
|
Stalk peptide is a GPR110 activator. Stalk peptide is released from GPCR Autoproteolysis INducing domain by autocatalytic process and then Stalk peptide is inserted into the ligand-binding pocket of the receptor to activate the receptor. Stalk peptide can promote nerve growth and synaptic formation. Stalk peptide can be used to study neurodevelopmental and neurodegenerative diseases .
|
-
- HY-P10436
-
|
|
Raf
|
Cancer
|
|
Braftide is an allosteric inhibitor for BRAF kinase by targeting the dimer interface of BRAF kinase and inhibiting the formation of BRAF dimers. Braftide inhibits wild-type BRAF and oncogenic BRAF G469A with IC50 of 364 nM and 172 nM, respectively. Braftide inhibits MAPK signaling pathway, inhibits proliferation of KRAS mutant tumor cells (EC50 is 7.1 and 6.6 μM, for HCT116 and HCT-15), in combination of TAT sequence .
|
-
- HY-P2138
-
|
|
HIV Protease
|
Others
|
|
U-85548E is an HIV protease inhibitor with nanomolar affinity for HIV-1 aspartic protease. By studying its structure-activity relationship, a potent nanomolar inhibitor with inhibitory effects on both HIV-1 and HIV-2 proteases was designed, and its binding mode was studied by X-ray crystallography and molecular modeling.
|
-
- HY-P0328
-
|
|
VSV
|
Infection
|
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
-
- HY-P0128
-
|
Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells .
|
-
- HY-P0241
-
-
- HY-P0150
-
-
- HY-P1879
-
-
- HY-P1843
-
|
|
Arenavirus
|
Infection
|
|
Glycoprotein (276-286) is a Db-restricted peptide derived from lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), corresponds to amino acids 276-286[1].
|
-
- HY-P2478
-
|
|
PD-1/PD-L1
|
Inflammation/Immunology
|
|
Human PD-L1 inhibitor V, a human PD-1 protein binding peptide with a Kd value of 3.32 μM. Human PD-L1 inhibitor V inhibit the interaction of hPD-1/hPD-L1 .
|
-
- HY-103283
-
|
GRP(18-27) (porcine)
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
Neuromedin C porcine (GRP, 18-27, porcine) is a bombesin-like neuropeptide that can be obtained from porcine spinal cord. Neuromedin C porcine exhibits a potent contractile activity on rat uterus in the characteristic manner of bombesin. Neuromedin C porcine has research potential for neurological-related diseases .
|
-
- HY-P1129
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
-
- HY-P5896
-
-
- HY-P4740
-
-
- HY-P5599
-
|
|
Bacterial
|
Infection
|
|
Temporin K is an antimicrobial peptide against Legionella pneumophila .
|
-
- HY-P5968
-
|
β(25-35)KA
|
Amyloid-β
|
Neurological Disease
|
|
[Ala28]-β Amyloid(25-35) (β(25-35)KA) is an electrically neutral mutant peptide of Aβ(25-35) that accelerates the aggregation of Firefly Luciferase .
|
-
![[Ala28]-β Amyloid(25-35)](//file.medchemexpress.eu/product_pic/hy-p5968.gif)
- HY-P10097
-
|
|
VEGFR
|
Others
|
|
Flt2 11 is a anti‐angiogenic peptide, and specifically binds NRP‐1. Flt2 11 inhibits NRP‐1/sVEGFR‐1 interaction.
|
-
- HY-P10521
-
|
|
VEGFR
|
Cancer
|
|
Apolipoprotein KV domain (67-77) is an 11-amino acid peptide identified from the KV domain of human apolipoprotein a (ApoA) with antiangiogenic and antitumor activities. Apolipoprotein KV domain (67-77) targets the angiogenic c-Src/ERK pathway by blocking activation signals received from vascular endothelial growth factor (VEGF). Apolipoprotein KV domain (67-77) can be used in cancer research .
|
-
- HY-P0255
-
-
- HY-P1729
-
-
- HY-P1823
-
|
|
Akt
mTOR
Caspase
|
Infection
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
C-Reactive Protein (CRP) is an anti-pneumococcal plasma protein that can serve as an inflammatory marker. C-Reactive protein can protect mice from pneumococcal infection by activating complement. C-Reactive protein can inhibit the activation of caspase-3/9 through the CD64/AKT/mTOR pathway, thereby promoting chemotherapy resistance in mice with tongue squamous cell carcinoma .
|
-
- HY-P1344
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
-
- HY-P1344A
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide TFA is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
-
- HY-P1163A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
![D[LEU4,LYS8]-VP TFA](//file.medchemexpress.eu/product_pic/hy-p1163a.gif)
- HY-P1163
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
-
![D[LEU4,LYS8]-VP](//file.medchemexpress.eu/product_pic/hy-p1163.gif)
- HY-P1191
-
|
TI-JIP; JIP-1 peptide; JIPtide
|
JNK
|
Others
|
|
JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
-
- HY-P1191A
-
|
TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA
|
JNK
|
Others
|
|
JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
-
- HY-P3419
-
-
- HY-146127
-
|
|
EGFR
|
Others
|
|
Grb2 SH2 domain inhibitor 1 is a conformationally restricted cyclic cell penetrating peptide (CPP) containing d-pro-l-pro motif ring (AF Φ Rpprrfq) (where Φ It is L-naphthylalanine, R is D-arginine, P is D-proline), which is mainly used as a cyclic peptide inhibitor.
|
-
- HY-P3929A
-
|
|
PKA
|
Cancer
|
|
PKI (14-24)amide TFA is a potent PKA inhibitor. PKI (14-24)amide strongly inhibited cyclic AMP-dependent protein kinase activity in the cell homogenate .
|
-
- HY-P4683
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a potent vasopressin V1 receptor (VP V1R) antagonist. (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin significantly decreases the mean arterial pressure (MAP) in rats .
|
-
- HY-P4237
-
-
![[8-L-arginine] deaminovasopressin](//file.medchemexpress.eu/product_pic/hy-p4237.gif)
- HY-148663
-
|
Tripalmitoyl pentapeptide
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
Mitogenic Pentapeptide (Tripalmitoyl pentapeptide) is an effective activator of B lymphocyte mitogen and polyclonal. Mitogen Pentapeptide is a synthetic N-terminal analog of E. coli outer membrane lipoproteins (cysteinyl-seryl-seryl-asparaginyl-alanine). Mitogenic Pentapeptide can be used for the study of immune adjuvants .
|
-
- HY-P5082
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein 4554W is an inhibitor of α-Synuclein (aSyn) aggregation with associated toxicity. α-Synuclein 4554W consists of GIVNGVKA sequences, previously identified through intracellular library screening. α-Synuclein 4554W reduces fibril formation of aSyn mutants assocaited with Parkinson’s disease .
|
-
- HY-P3419A
-
-
- HY-P4943
-
-
- HY-P4960
-
-
- HY-P0128F
-
-
- HY-P10037
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β Amyloid(17-28) human is a β-amyloid peptide (Abeta), a lipid-induced amyloid core fragment. β Amyloid(17-28) human enhances aggregation of full-length β Amyloid40, producing toxic aggregates in Alzheimer's disease (AD) .
|
-
- HY-P10179
-
-
- HY-P4683A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a potent vasopressin V1 receptor (VP V1R) antagonist. (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin significantly decreases the mean arterial pressure (MAP) in rats .
|
-
- HY-P10119
-
|
|
PDGFR
|
Others
|
|
PDGFR Y1021 peptide (non-phosphorylation) is the non-phosphorylated fragment of platelet-derived growth factor receptor (PDGFR). PDGFR Y1021 peptide (non-phosphorylation) blocks the PLCγ association to PDGFR through PLCγSH2 domain, and thus inhibits mitogenic response .
|
-
- HY-P10282
-
|
|
CaMK
|
Neurological Disease
|
|
Synapsin I-(3-13), a substrate for CaMK1, is a glycoprotein. Synapsin I is a phosphoprotein that coats the cytoplasmic side of synaptic vesicles and regulates their trafficking within nerve terminals .
|
-
- HY-P10286
-
|
|
MDM-2/p53
|
Cancer
|
|
Phage-derived 12/1 peptide exhibits antitumor activity by targeting MDM2 and MDMX, an thus disrupt the MDM2-p53 and MDMX-p53 interaction, with IC50 of 0.15 and 1.25 μM .
|
-
- HY-P10552
-
|
|
CXCR
|
Inflammation/Immunology
|
|
pCXCL8-1aa is an anti-inflammatory peptide. pCXCL8-1aa competitively inhibits the binding of CXCL8 to glycosaminoglycans such as heparin sulfate (HS) by binding with high affinity. This reduces the presentation of CXCL8 on the surface of vascular endothelial cells, thereby inhibiting neutrophil migration and inflammatory responses. pCXCL8-1aa can be used to study inflammatory diseases such as rheumatoid arthritis .
|
-
- HY-P10848
-
|
|
Bacterial
|
Infection
|
|
RJPXD33 is the inhibitor for LpxD and LpxA with IC50 of 3.5 μM and 19 μM. RJPXD33 RJPXD33 inhibits LpxD and LpxA in E. coli with Kd of 6 μM and 20 μM .
|
-
- HY-17571A
-
|
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P0234
-
|
|
Neurotensin Receptor
|
Endocrinology
Cancer
|
|
Neurotensin, a gut tridecapeptide, acts as a potent cellular mitogen for various colorectal and pancreatic cancers which possess high-affinity neurotensin receptors (NTR).
|
-
- HY-P1746
-
|
PKC (19-31)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31), a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31), is used as protein kinase C substrate peptide for testing the protein kinase C activity .
|
-
- HY-P1749
-
|
|
Influenza Virus
|
Infection
|
|
Influenza HA (307-319) is 13 amino acids 307 to 319 fragment of Influenza HA. Influenza HA is a glycoprotein found on the surface of influenza viruses .
|
-
- HY-P1774
-
|
|
HBV
|
Infection
|
|
Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
|
-
- HY-P1746A
-
|
PKC (19-31) (TFA)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31) TFA, a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31), is used as protein kinase C substrate peptide for testing the protein kinase C activity .
|
-
- HY-P1390
-
|
|
Vasopressin Receptor
|
Endocrinology
|
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
![d[Cha4]-AVP](//file.medchemexpress.eu/product_pic/hy-p1390.gif)
- HY-P1390A
-
|
|
Vasopressin Receptor
|
Endocrinology
|
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
-
![d[Cha4]-AVP TFA](//file.medchemexpress.eu/product_pic/hy-p1390a.gif)
- HY-P2198A
-
-
- HY-P2548
-
|
|
EGFR
|
Others
|
|
pp60 (v-SRC) Autophosphorylation Site, Phosphorylated is the phosphorylated peptide of an EGFR substrate. pp60 (v-SRC) Autophosphorylation Site, Phosphorylated can be used for the screening of EGFR Kinase inhibitors via phosphorylated-substrate quantification .
|
-
- HY-P4133
-
|
|
ERK
MEK
|
Cancer
|
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable .
|
-
- HY-P4699
-
|
|
JNK
|
Others
|
|
(Thr17)-c-Jun (11-23) is a fragment peptide of c-Jun.
|
-
- HY-P5258
-
|
|
EGFR
|
Metabolic Disease
|
|
Oligopeptide-41 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
-
- HY-P4777
-
|
Dabcyl-CMV-Edans
|
Fluorescent Dye
|
Infection
|
|
Dabcyl-RGVVNASSRLA-Edans (Dabcyl-CMV-Edans) is a fluorogenic substrate for human cytomegalovirus (HCMV) protease .
|
-
- HY-P10072
-
|
Hsp25 kinase inhibitor; Mk2 pseudosubstrate
|
ERK
JNK
p38 MAPK
HSP
MAPKAPK2 (MK2)
|
Others
|
|
MK2-IN-5 is a Mk2 pseudosubstrate (Ki= 8 μM). MK2-IN-5 targets the protein interaction domain in the MAPK pathway. MK2-IN-5 inhibits HSP25 and HSP27 phosphorylation .
|
-
- HY-17571
-
|
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
-
- HY-P10072A
-
|
Hsp25 kinase inhibitor acetate; Mk2 pseudosubstrate acetate
|
JNK
HSP
MAPKAPK2 (MK2)
p38 MAPK
ERK
|
Others
|
|
MK2-IN-5 (Hsp25 kinase inhibitor) acetate is a Mk2 pseudosubstrate (Ki= 8 μM). MK2-IN-5 acetate targets the protein interaction domain in the MAPK pathway. MK2-IN-5 acetate inhibits HSP25 and HSP27 phosphorylation .
|
-
- HY-125745
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Loloatin B 10 is an antibiotic, which exhibits antibacterial efficacy against gram positive antibiotic resistant human pathogens .
|
-
- HY-P10367
-
|
|
MAPKAPK2 (MK2)
Checkpoint Kinase (Chk)
AMPK
|
Others
|
|
Ziptide is a substrate for MAPK activated protein kinase 2 (MAPKAPK2, Km = 5 μM), MAPKAPK3 (Km = 30 μM), PARK (Km = 40 μM), checkpoint kinase 1 (Chk1, Km = 5 μM), AMP-activated protein kinase (AMPK, Km = 75 μM), and calcium/calmodulin-dependent protein kinase II (CamKII, Km = 300 μM) .
|
-
- HY-P10364
-
|
UBI(29-41)
|
Bacterial
Antibiotic
|
Inflammation/Immunology
|
|
Ubiquicidin(29-41) is an antimicrobial peptide highly homologous to S30. Ubiquicidin(29-41) targets bacterial and fungal. Ubiquicidin(29-41) can be used as a membrane-specific infection localizer .
|
-
- HY-P10486
-
|
|
Bacterial
|
Infection
|
|
AIP-II is a macrocyclic peptide signaling molecule used for quorum sensing, which can be produced be Staphylococcus aureus. AIP-II binds to AgrC-II receptor, regulates the virulence gene expression in Staphylococcus aureus. AIP-II is an antagonist for AgrC-I receptor .
|
-
- HY-P10511
-
|
|
Apoptosis
|
Infection
Cancer
|
|
Pantinin-3 is an antimicrobial peptide with antitumor activity found in the venom of the emperor scorpion (Pandinus imperator). Pantinin-3 shows selective toxicity against breast cancer cells (MDA-MB-231) and prostate cancer cells (DU-145). Pantinin-3 can induce apoptosis in tumor cells. Pantinin-3 can be used in cancer research .
|
-
- HY-159064S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
DSPSAPVNVT(Val- 13C5, 15)R TFA is the 13C and 15N-labeled DSPSAPVNVT(Val)R. Radioactive isotopes labeled compounds can be used in metabolic analysis, allowing the movement of individual atoms to be precisely tracked and quantified .
|
-
- HY-P10609
-
|
|
Btk
|
Others
|
|
Btk substrate peptide is a peptide substrate corresponding to residues 217-229 of human Bruton’s tyrosine kinase (Btk), of which the tyrosine at residue 223 is the major autophosphorylation site of Btk. Btk substrate peptide is used as a substrate in in vitro kinase assays to evaluate the activity of Btk or other tyrosine kinases .
|
-
- HY-P0049
-
|
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
-
- HY-A0182
-
-
- HY-P0004
-
|
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
-
- HY-P0083
-
-
- HY-P1474
-
|
Amyloid β-Protein (22-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution) .
|
-
- HY-P1486
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .
|
-
- HY-P1869
-
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
-
- HY-P1474A
-
|
Amyloid β-Protein (22-35) (TFA)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 TFA forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution) .
|
-
- HY-P1754A
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Tetanus toxin (830-843) TFA is a powerful neurotoxin that reaches by retroaxonal transport and transcytosis the cytoplasm ofspinal inhibitory intemeurons and blocks their ability to release neurotransmitters .
|
-
- HY-P0118A
-
|
P144 TFA
|
TGF-beta/Smad
PI3K
Apoptosis
|
Cancer
|
Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis inducer .
|
-
- HY-P3057
-
-
![[D-Trp11]-Neurotensin](//file.medchemexpress.eu/product_pic/hy-p3057.gif)
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
-
- HY-P4136
-
|
|
ERK
|
Cancer
|
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM .
|
-
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P4605
-
-
- HY-P4832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Acetyl-Tau Peptide (273-284) amide is an acetylated Tau peptide fragment. Acetyl-Tau Peptide (273-284) amide limits the substantial aggregation of Ac-Aβ(25–35)-NH2 and can be used as an inhibitor of Ac-Aβ(25–35)-NH2. Acetyl-Tau Peptide (273-284) amide can be used as an experimental model to investigate the Aβ/Tau cross-interaction .
|
-
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
-
- HY-P3833A
-
-
- HY-P1828A
-
|
|
EGFR
|
Cancer
|
|
EGFRvIII peptide (PEPvIII) TFA is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide TFA represents a truly tumor-specific target for antitumor immunotherapy .
|
-
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P4994
-
-
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
-
- HY-P4920
-
|
|
Fluorescent Dye
|
Others
|
|
Mca-SEVNLDAEFK(Dnp)-NH2 contains a highly fluorescent 7-methoxycoumarin group that is efficiently quenched by resonance energy transfer to the 2,4-dinitrophenyl group. It can be used to measure the activities of peptidases that are capable of cleaving an amide bond between the fluorescent group and the quencher group, causing an increase in fluorescence, such as can be used to measure the activity of BACE-1 .
|
-
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
-
- HY-P5592
-
|
|
Bacterial
|
Infection
|
|
Temporin B is an antimicrobial peptide against Legionella pneumophila .
|
-
- HY-P5598
-
|
|
Bacterial
|
Infection
|
|
Temporin G is an antimicrobial peptide against Legionella pneumophila .
|
-
- HY-P4978
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
CBP501 Affinity Peptide is a Chk kinase inhibitor that can abrogate G2 arrest induced by DNA-damaging agents. CBP501 Affinity Peptide can be used in cancer research .
|
-
- HY-P0128F1
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-β-Amyloid (25-35) is a fluorescent product labeled by FITC that can be used in Alzheimer's disease research .
|
-
- HY-P5998
-
|
|
Myosin
|
Cancer
|
|
Myosin Light Chain Kinase Substrate (smooth muscle) is a smooth muscle myosin light chain kinase (MLCK) synthetic peptide substrate .
|
-
- HY-P5866
-
|
Manse-AT
|
Endogenous Metabolite
|
Endocrinology
|
|
Allatotropin (Manse-AT) is a 13 amino acid neuropeptide. Allatotropin activates inositol 1,4,5-trisphosphate (IP3) pathway, and the biosynthesis of juvenile hormone (JH) in Manduca sexta .
|
-
- HY-P10307
-
-
- HY-P2223
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Hypeptin is a cyclo-deposited peptide antibiotic produced by Lysobacter sp.K5869. Hypeptin blocks bacterial cell wall biosynthesis by binding to multiple undecaprenyl pyrophosphate-containing biosynthesis intermediates, forming a stoichiometric 2:1 complex. Hypeptin has antibacterial activity .
|
-
- HY-P4605A
-
-
- HY-P0195
-
-
- HY-P2161A
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 TFA is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 TFA is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 TFA depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P2161
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P2161B
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 acetate is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 acetate is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 acetate depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
-
- HY-P3281
-
|
|
Biochemical Assay Reagents
|
Others
|
|
FGL peptide, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
-
- HY-P3213
-
-
![Dp[Tyr(methyl)2,Arg8]-Vasopressin](//file.medchemexpress.eu/product_pic/hy-p3213.gif)
- HY-P5072
-
|
|
Bombesin Receptor
|
Metabolic Disease
|
|
GRP (14-27) (human, porcine, canine) is a bombesin receptor ligand. The specific binding of GRP (14-27) is inhibited by GTP and GDP, whereas GMP was without effect .
|
-
- HY-P5727
-
|
|
Bacterial
|
Infection
|
|
HR1 is a mastoid protease. HR1 can increase the permeability of human erythrocyte membrane. HR1 can induce cytoplasmic membrane permeation in bacteria and mast cells .
|
-
- HY-W343750
-
-
![[Tyr4]-Bombesin](//file.medchemexpress.eu/product_pic/hy-w343750.gif)
- HY-P5969
-
-
- HY-P5977
-
|
Ste-MPKKKPTPIQLNP-NH₂; ERK Activation Inhibitor Peptide
|
ERK
|
Cancer
|
|
STE-MEK1(13) (Ste-MPKKKPTPIQLNP-NH ) is a cell permeable ERK1/2 inhibitor (IC50: 13-30 μM). STE-MEK1(13) inhibits ERK1/2 phosphorylation .
|
-
- HY-P10046
-
|
|
Vasopressin Receptor
|
Metabolic Disease
|
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
-
![[Deamino-Pen1,Val4,D-Arg8]-vasopressin](//file.medchemexpress.eu/product_pic/hy-p10046.gif)
- HY-P10148
-
|
Ac-[Leu28,31]-NPY (24-36)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) is a selective agonist of neuropeptide Y Y2 receptor. N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) attenuates cardiac vagal action in anaesthetised rats .
|
-
![N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36)](//file.medchemexpress.eu/product_pic/hy-p10148.gif)
- HY-P10310
-
|
|
HIV
|
Infection
|
|
F9170 is an amphipathic peptide with an activity of inactivate HIV-1 virions. F9170 targets the conserved cytoplasmic tail of HIV-1 env and disrupts the integrity of the viral membrane. F9170 is able to cross the blood-brain barrier (BBB) .
|
-
- HY-P10463
-
|
|
Histone Methyltransferase
|
Cancer
|
|
ssK36 is a supersubstrate peptide of the histone methyltransferase (SET) domain protein 2 (SETD2), and ssK36 is designed for the SETD2 protein, a specific PKMT. It is responsible in human cells for adding methyl groups to the 36th lysine residue of histone H3 (H3K36) to form H3K36me3. ssK36 can be methylated by SETD2 at a rate more than 100 times faster than the natural substrate H3K36. ssK36 can be used to study the catalytic mechanism of PKMTs, especially substrate specificity and catalytic efficiency .
|
-
- HY-P10399
-
|
Mouse KGYY15; KGYY15 peptide
|
TNF Receptor
|
Metabolic Disease
|
|
KGYY15 (Mouse KGYY15) is a CD40 targeting peptide, which weakly inhibits the CD40-CD40L interaction with IC50 of more than 1mM. KGYY15 activates 33% NF-κB pathway at 100 μM .
|
-
- HY-P10529
-
|
|
Trk Receptor
|
Infection
|
|
Ganglioside GM1-binding peptides p3 is a synthetic peptide that can specifically bind to the pentasaccharide part of GM1 ganglioside. The dynamic transformation of Ganglioside GM1-binding peptides p3 may play an important role in the function of GM1 as a multiple receptor, such as in the classical pathway of cholera toxin infection. Ganglioside GM1-binding peptides p3 can be used to study the interaction between GM1 and its ligands .
|
-
- HY-P1134
-
|
|
5-HT Receptor
|
Neurological Disease
|
|
Galanin (1-15) (porcine, rat) is the N-terminal 15 amino acids peptide fragment of the neuropeptide galanin. Galanin (1-15) (porcine, rat) interacts with the 5-HT1A receptor in the dorsal hippocampus of the rat brain, reduces the affinity of 5-HT1A receptors, and regulates the serotonin neuronal networks .
|
-
- HY-P10729
-
|
|
Others
|
Cancer
|
|
DOTA-Bombesin (1-14) is a radionuclide conjugate (RDC), which is capable of binding to a radionuclide. RDC has the ability to specifically target biomolecules and can be used in medical imaging or therapy .
|
-
- HY-P0300
-
|
|
Bcl-2 Family
|
Cancer
|
|
Bak BH3 is derived from the BH3 domain of Bak, can antagonize the function of Bcl-xL in cells.
|
-
- HY-P1592
-
G3-C12
1 Publications Verification
|
Galectin
|
Cancer
|
|
G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
-
- HY-P1578
-
-
- HY-P1578A
-
-
- HY-P1735
-
-
- HY-P1818
-
-
- HY-P1898
-
-
- HY-P2155A
-
-
- HY-P2155
-
-
- HY-P1382
-
|
|
Ras
|
Cancer
|
|
Rac1 Inhibitor W56 is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
-
- HY-P1382A
-
|
|
Ras
|
Cancer
|
|
Rac1 Inhibitor W56 TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 TFA inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
-
- HY-P2344
-
|
|
HIV Protease
|
Infection
|
|
HIV Protease Substrate 1, a fiuorogenic HIV protease substrate, can be used to study enzymatic activity of HIV protease .
|
-
- HY-P2344A
-
|
|
HIV Protease
|
Infection
|
|
HIV Protease Substrate 1 TFA, a fiuorogenic HIV protease substrate, can be used to study enzymatic activity of HIV protease .
|
-
- HY-P4027
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
-
- HY-P4117
-
-
- HY-P4027A
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (554-569) TFA is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) TFA contains a putative N-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
-
- HY-P4899
-
|
|
Beta-secretase
|
Neurological Disease
|
|
RE (EDANS) EVNLDAEFK (DABCYL) R is an EDANS and DABCYL double-labeled peptide，serves as a fluorescent substrate for BACE1(Em=360nm，Ex=528nm). RE (EDANS) EVNLDAEFK (DABCYL) R can be used for BACE1 activity measurement and the enzyme activity level is directly proportional to the fluorescence reaction .
|
-
- HY-P5391
-
|
|
Bacterial
|
Others
|
|
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
|
-
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
-
- HY-103287
-
|
|
Bombesin Receptor
|
Cancer
|
|
[D-Phe12,Leu14]-Bombesin is an antagonist of Bombesin Receptor. [D-Phe12,Leu14]-Bombesin can be used for the research of cancer .
|
-
![[D-Phe12,Leu14]-Bombesin](//file.medchemexpress.eu/product_pic/hy-103287.gif)
- HY-P5985
-
mSIRK
1 Publications Verification
|
ERK
|
Others
|
|
mSIRK (G-Protein βγ Binding Peptide) is an cell-permeable activator of ERK1/2, with EC50 of 2.5-5 μM. mSIRK disrupts the interaction between α and βγ subunits and promotes α subunit dissociation without stimulating nucleotide exchange .
|
-
- HY-103282
-
|
|
Bombesin Receptor
|
Others
|
|
[D-Phe12]-Bombesin is a derivative of Bombesin (HY-P0195) and an antagonist for bombesin receptor with Ki of 4.7 μM. [D-Phe12]-Bombesin inhibits the Bombesin (HY-P0195)-induced amylase release, with IC50 of 4 μM .
|
-
![[D-Phe12]-Bombesin](//file.medchemexpress.eu/product_pic/hy-103282.gif)
- HY-159046S
-
-
- HY-P10596
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
Lasioglossin-III is an antimicrobial peptide that can be isolated from the venom of wild bees. Lasioglossin-III has high antibacterial activity against Gram-positive and Gram-negative bacteria, antifungal activity and antitumor activity. Lasioglossin-III has certain cytotoxicity against three cancer cell lines (HeLa S3, CRC SW 480 and CCRF-CEM T) with IC50 values of 4, 18 and 5 μM, respectively .
|
-
- HY-P10614
-
|
|
Apoptosis
Bcl-2 Family
|
Others
|
|
Bid BH3 peptide is a small peptide derived from Bid protein that can bind and activate the pro-apoptotic proteins Bax and Bak, leading to mitochondrial outer membrane permeabilization (MOMP) and apoptosis. Bid BH3 peptide can be used to study mitochondrial bioenergetics .
|
-
- HY-P10800
-
|
|
Deubiquitinase
|
Cancer
|
|
T20-M is a lead peptide that shows good potential for binding affinity towards UBE2C .
|
-
- HY-P10832
-
|
|
Apoptosis
Ras
Raf
MEK
ERK
Caspase
PARP
Bcl-2 Family
|
Cancer
|
|
ATWLPPRAANLLMAAS is a chimeric peptide with anti-angiogenic and potent anti-tumor effects. ATWLPPRAANLLMAAS can inhibit the proliferation, viability, migration, and invasion of human hepatocellular carcinoma cells, and induce apoptosis. .
|
-
- HY-12554
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
|
Terlipressin is a vasopressin analogue with potent vasoactive properties. Terlipressin is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin exerts anti-inflammatory and anti-oxidative effects. Terlipressin has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P0183
-
-
- HY-P1051
-
|
Amyloid β-Protein (12-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (Amyloid β-Protein (12-28)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) shows aggregation properties. β-Amyloid (12-28) has the potential for Alzheimer’s disease research .
|
-
- HY-P1586
-
|
HIV-1 rev Protein (34-50)
|
HIV
|
Infection
|
|
HIV-1 Rev (34-50) is a 17-aa peptide derived from the Rev-responsive element (RRE)-binding domains of Rev in HIV-1, with anti-HIV-1 activity.
|
-
- HY-P1846
-
|
|
Notch
|
Cancer
|
|
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
|
-
- HY-P1051A
-
|
Amyloid β-Protein (12-28) (TFA); Amyloid Beta-Peptide (12-28) (human) TFA; β-Amyloid protein fragment(12-28) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (TFA) (Amyloid β-Protein (12-28) (TFA)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) (TFA) shows aggregation properties. β-Amyloid (12-28) (TFA) has the potential for Alzheimer’s disease research .
|
-
- HY-12554A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-P1333
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A can induce neuronal death, and can be used in the research of neurological disease .
|
-
- HY-P1333A
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A TFA is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A TFA is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A TFA can induce neuronal death, and can be used in the research of neurological disease .
|
-
- HY-P2470
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human PD-L1 inhibitor II is a potent PD-L1 inhibitor with anti-cancer activity .
|
-
- HY-P4093
-
-
- HY-P5367
-
|
PMDM6-F
|
Fluorescent Dye
|
Others
|
|
5-FAM-PMDM6 (PMDM6-F) is a biological active peptide. (PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.)
|
-
- HY-P5638
-
|
|
Bacterial
|
Infection
|
|
FLGFVGQALNALLGKL-NH2 is an antimicrobial peptide of frog origin. FLGFVGQALNALLGKL-NH2 has activity against Staphylococcus aureus ATCC 29213 (MIC=32 μM) .
|
-
- HY-12554B
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
-
- HY-163427S
-
-
- HY-P10393
-
|
ERα (295-311)
|
Apoptosis
|
Cancer
|
|
ERα17p (ERα 295-311) is the epitope of the CaM binding site on the estrogen receptor α (ER), which interacts with calmodulin (CaM) in a calcium-dependent manner. ERα17p regulates the migration of cancer cells MCF-7, SK-BR-3, T47D, and MDA-MB-231 through Rho/ROCK and PI3K/Akt signaling pathways. ERα17p inhibits proliferations of breast cancer cells, induces apoptosis, and inhibits tumor growth in mouse models .
|
-
- HY-P10659
-
|
|
EGFR
|
Cancer
|
|
Self-assembling peptide pY1 is a peptide that assemblies around cancer cells and targets EGFR. When co-cultured with Ovalbumin (OVA), pY1 can effectively block the endocytosis of OVA .
|
-
- HY-P1777
-
|
Insulin-like Growth Factor I (24-41)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) regulates somatic growth and behavioral development .
|
-
- HY-P1212
-
|
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
-
- HY-P1872
-
|
|
Bacterial
|
Infection
|
|
OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa .
|
-
- HY-P1777A
-
|
Insulin-like Growth Factor I (24-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) TFA regulates somatic growth and behavioral development .
|
-
- HY-P1341
-
|
Orexin A (17-33) (human, mouse, rat, bovine)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
OXA(17-33) is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
-
- HY-P1341A
-
|
Orexin A (17-33) (human, mouse, rat, bovine) TFA
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
OXA(17-33) TFA is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) TFA shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
-
- HY-P1111
-
|
|
Src
Interleukin Related
|
Inflammation/Immunology
|
|
Lyn peptide inhibitor is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor can be used for study of asthma, allergic, and other eosinophilic disorders .
|
-
- HY-P1111A
-
|
|
Src
Interleukin Related
|
Inflammation/Immunology
|
|
Lyn peptide inhibitor TFA is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor TFA blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor TFA can be used for study of asthma, allergic, and other eosinophilic disorders .
|
-
- HY-P1118
-
-
- HY-P1118A
-
-
- HY-P2474
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human PD-L1 inhibitor I is a hPD-1 peptide ligand, with a KD of 3.39 μM. Human PD-L1 inhibitor I may disturb the binding of hPD-L1 to hPD-1 .
|
-
- HY-P2492
-
|
|
Angiotensin Receptor
|
Metabolic Disease
|
|
Renin FRET Substrate I is a substrate of human renin. Renin FRET Substrate I is designed to incorporate the renin cleavage site that occurs in the N-terminal peptide of human angiotensinogen .
|
-
- HY-P2545
-
-
![[Tyr1]-Somatostatin-14](//file.medchemexpress.eu/product_pic/hy-p2545.gif)
- HY-P4397
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
-
- HY-P5295
-
|
|
Fluorescent Dye
|
Others
|
|
Cy3-Ova (323-339) is an Cy3 labled OVA Peptide (323-339) (HY-P0286). Cy3 is a fluorescent dye belonging to the Cyanine family and is a fluorescent light product of Cy5. Cyanine is commonly used in fluorescence microscopy, cell imaging, and molecular biology experiments. OVA Peptide (323-339) represents the T and B cell epitopes of ovalbumin (OVA). OVA Peptide (323-339) has limited immunogenic efficacy in activating OVA-sensitized and attacked mouse spleen cells .
|
-
- HY-P0300F
-
-
- HY-P5885
-
|
|
PKC
|
Others
|
|
PKCη pseudosubstrate inhibitor,myristoylated is cell permeable and can be used to study the mechanism of action of PKCη .
|
-
- HY-P2442
-
|
|
Bacterial
|
Others
|
|
Bombolitin V is a potent antimicrobial peptide with an ED 50 value of 2 micrograms/ml in causing mast cell degranulation .
|
-
- HY-P5016
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
Cancer
|
|
CRAMP-18 (mouse) is an antibiotic peptide without hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has the potential to study antifungal, antibacterial and antitumor .
|
-
- HY-P5654
-
|
|
Bacterial
|
Infection
|
|
Bombolitin IV is an antimicrobial peptide derived from bumblebee venom. Bombolitin IV can lysate erythrocyte and liposome .
|
-
- HY-P10252
-
|
|
HIV
|
Inflammation/Immunology
|
|
HIV gp120 421-438 is HIV antigen fragments, that conjugates with keyhole limpet hemocyanin (KLH) and generates specific anti-HIV antibody .
|
-
- HY-P10283
-
|
|
GHSR
STAT
|
Endocrinology
|
|
S1H, a mimetic of hGH, is a human growth hormone receptor (hGHR) antagonist. S1H inhibits the interaction of hGH with hGHR. S1H inhibits phosphorylation of STAT5 in cells co-treated with hGH .
|
-
- HY-P2191
-
|
|
Kisspeptin Receptor
|
Endocrinology
|
|
KISS1-305, the Metastin/Kisspeptin analog, is a prototype peptide and a chemical probe. KISS1-305 has suboptimal KISS1R agonistic activity, and resists plasma protease degradation .
|
-
- HY-P10803
-
|
|
SARS-CoV
|
Infection
|
|
FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to SARS-CoV-2 receptor-binding domain (RBD). FLDKFNHEAEDLFYQSSL inhibits the entry of SARS-Cov-2. FLDKFNHEAEDLFYQSSL also interacts with binding residues (Leu455, Phe456, Ala475 and Gln493) .
|
-
- HY-P1246
-
-
- HY-P1588
-
-
- HY-P1932A
-
-
- HY-P2243
-
-
- HY-P4138
-
|
|
Fluorescent Dye
|
Cancer
|
|
Antennapedia Peptide FAM-labeled is a fluorophore labeled peptide. Antennapedia Peptide FAM-labeled also can be used for the research of cancer as a molecular probe .
|
-
- HY-P4351
-
|
|
HIV
|
Others
|
|
HIV-1 gag Protein p24 (194-210) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4792
-
-
- HY-P5276
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human membrane-bound PD-L1 polypeptide can be used as an antigen to induce PD-L1 antibody production .
|
-
- HY-P0286F1
-
-
- HY-P5675
-
|
|
Bacterial
|
Infection
|
|
Bombinin H7 is an antimicrobial peptide derived from skin secretions of Bombina. Bombinin H7 is active against Bacillus megaterium Bm11 with a lethal concentration of 25.2 μM .
|
-
- HY-P10396
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Elf18 is the bacterial N-terminal fragment of Elongation Factor Thermus (EF-Tu). Elf18 is recognized by pattern recognition receptors (PRRs) as a pathogen-associated molecular pattern (PAMP), and thus induces immune response in Arabidopsis .
|
-
- HY-P10562
-
|
|
TMV
|
Others
|
|
BMV Gag-(7−25) is an arginine-rich peptide with cell-penetrating ability. BMV Gag-(7−25) can be used in drug delivery and gene therapy research .
|
-
- HY-P10515
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
AcrAP2 is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP2 is inhibitory against Gram-positive bacteria and yeast but is essentially inactive against Gram-negative bacteria. A cation-enhanced AcrAP2 analog (AcrAP2a) exhibits significant antiproliferative effects at low concentrations against certain human cancer cell lines. AcrAP2 can be used in antibacterial and anti-tumor research .
|
-
- HY-P10780
-
|
Neuropeptide NPVF (mouse)
|
Neuropeptide FF Receptor
Apoptosis
MDM-2/p53
PERK
|
Endocrinology
|
|
RFRP-3 (mouse) is a functional ortholog of avian gonadotropin inhibitory hormone (GnIH), binding to GPR147. RFRP-3 (mouse) reduces Progesterone synthesis by inhibiting FSHR and key enzymes involved in steroidogenesis (P450scc, 3β-HSD, StAR). RFRP-3 (mouse) induces Apoptosis (increase of p53). RFRP-3 (mouse) also suppresses the ERK signaling pathway. RFRP-3 (mouse) can be used for research of follicular development .
|
-
- HY-P1479
-
|
|
Autophagy
CaMK
|
Neurological Disease
|
|
Calmodulin-Dependent Protein Kinase II (290-309) is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II .
|
-
- HY-P1875A
-
-
- HY-P2299
-
|
|
HPV
|
Cancer
|
|
Protein E7(43-62) is an E7-derived peptide with anti-tumor effects (short peptide spanning the 43th to 62th amino acid residues in the E7 protein) .
|
-
- HY-P0222
-
|
|
PKA
|
Others
|
|
PKI(5-24) is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
-
- HY-P0222A
-
|
|
PKA
|
Others
|
|
PKI(5-24) TFA is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) TFA corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
-
- HY-P1039
-
|
PHCVPRDLSWLDLEANMCLP
|
Raf
|
Cancer
|
|
R18 is a peptide antagonists of 14-3-3, with a KD of 70-90 nM. R18 efficiently blocks the binding of 14-3-3 to the kinase Raf-1, a physiological ligand of 14-3-3, and effectively abolished the protective role of 14-3-3 against phosphatase-induced inactivation of Raf-1 .
|
-
- HY-P1039A
-
|
PHCVPRDLSWLDLEANMCLP TFA
|
Raf
|
Cancer
|
|
R18 TFA is a peptide antagonists of 14-3-3, with a KD of 70-90 nM. R18 efficiently blocks the binding of 14-3-3 to the kinase Raf-1, a physiological ligand of 14-3-3, and effectively abolished the protective role of 14-3-3 against phosphatase-induced inactivation of Raf-1 .
|
-
- HY-P2466
-
|
|
Apoptosis
|
Cancer
|
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models .
|
-
- HY-P3066
-
|
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
-
- HY-P3678
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Neuropeptide Y (18-36) (porcine) is a competitive neuropeptide Y (NPY) cardiac receptor antagonist. Neuropeptide Y (18-36) (porcine) inhibits the binding of I-NPY to cardiac ventricular membranes in a concentration-dependent manner with an IC50 value of 158 nM and an Ki value of 140 nM. Neuropeptide Y (18-36) (porcine) can be used for the research of congestive heart failure .
|
-
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P4106A
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
-
- HY-P5305A
-
|
|
GABA Receptor
|
Metabolic Disease
|
|
GAD65(247-266) epitope TFA is the T cell epitopes of islet antigens，binding to I-A g7 (type I diabetes-associated molecule) competitively with poor affinity. GAD65 refers to Glutamic Acid Decarboxylase 65，involved in the conversion of glutamate to gamma-aminobutyric acid (GABA) .
|
-
- HY-P1527
-
|
|
Bcl-2 Family
|
Others
|
|
Bim BH3 is a biological active peptide. (This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.)
|
-
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
-
- HY-P5330
-
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
-
- HY-P5505
-
|
|
Arenavirus
|
Others
|
|
LCMV-derived p13 epitope is a biological active peptide. (An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV) pre-glycoprotein polyprotein GP complex. LCMV has been routinely used for the study of adaptive immune responses to viral infection.)
|
-
- HY-P5545
-
|
|
Bacterial
|
Infection
|
|
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection .
|
-
- HY-P10445
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4 that disrupts the BRD4/JMJD6 interaction. BRD4/JMJD6 is a protein complex that is critical for oncogene expression and breast cancer, and TAT-PiET inhibits BRD4/JMJD6 target gene expression and breast cancer cell growth. TAT-PiET also resists endocrine resistance in ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
-
- HY-P10437
-
|
human α1-AT(353-372)
|
HIV
|
Infection
|
|
VIRIP (human α1-AT(353-372)) is a HIV-1 inhibitor. VIRIP blocks the entry of HIV-1 by interacting with gp41 fusion peptide. VIRIP can be used for virus research .
|
-
- HY-P10458
-
|
Human/rat 5-LO (130-149)
|
Lipoxygenase
|
Others
|
|
5-Lipoxygenase blocking peptide (Human/rat 5-LO 130-149) is a specific sequence fragment of 5-lipoxygenase (5-LOX), which can be utilized to prepare an antibody against 5-LOX .
|
-
- HY-P10625
-
|
|
Apoptosis
|
Metabolic Disease
Cancer
|
|
SHLP-6 is a mitochondrial-derived peptide, a biologically active microprotein encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP6 increases apoptosis in insulinoma cells NIT1 and human prostate cancer cell 22Rv1. SHLP6 can be used in the study of diabetes and cancer .
|
-
- HY-P6312
-
|
|
Bacterial
|
Infection
|
|
ESAT6 Epitope is a known CD4+ T cell epitope in early secretory antigen target gene 6 (ESAT6) that binds to major histocompatibility complex MHC class I with nanometer affinity (IC50=180 nM). ESAT6 Epitope can be used to enhance BCG-induced anti-Mycobacterium tuberculosis cellular immunity .
|
-
- HY-P10856
-
|
|
ATP-binding Cassette (ABC) transporter
|
Cancer
|
|
CPI1 is a potent and highly specific multidrug resistance protein 1 (MRP1) inhibitor. CPI1 inhibits MRP1 (Ki: 100 nM) with nanomolar potency but shows minimal inhibition of P-glycoprotein (Pgp). CPI1 and LTC4 compete to bind to the same site of MRP1, inhibiting ATP hydrolysis and substrate transport. CPI1 can be used to study drug delivery and chemotherapy resistance in cancer .
|
-
- HY-15664
-
-
- HY-P0262
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Endocrinology
|
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM) .
|
-
- HY-P1025
-
-
- HY-P1831
-
|
ProAM N20, Human; PAMP-20, human
|
nAChR
|
Neurological Disease
|
|
Proadrenomedullin (1-20), human is a potent hypotensive and catecholamine release–inhibitory peptide released from chromaffin cells with an IC50 of ~350 nM for catecholamine secretion in PC12 pheochromocytoma cells, acting in a noncompetitive manner specifically at the nicotinic cholinergic receptor .
|
-
- HY-P1929
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Bivalirudin, a peptide anticoagulant, is a direct thrombin inhibitor for anticoagulation in the setting of invasive cardiology, particularly percutaneous coronary intervention .
|
-
- HY-P2343
-
|
|
Apoptosis
|
Cancer
|
|
BH3 hydrochloride, a BBB penetrated peptide, provoke apoptosis either by direct activation of pro-apoptotic Bax/Bak or by neutralizing anti-apoptotic Bcl-2 proteins (Bcl-2, Bcl-XL, Bcl-w, Mcl-1 and A-1) via their BH3 domian .
|
-
- HY-P1131
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
|
M617 is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
-
- HY-P1131A
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
|
M617 TFA is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617 TFA, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
-
- HY-P0262A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
|
|
Galantide TFA is a reversible and non-specific galanin (GAL) receptor antagonist. Galantide TFA dose-dependently shows antagonism to galanin-induced K + conductance with an IC50 value of 4 nM. Galantide TFA can be used for the research of neurological disease and hormone metabolism research .
|
-
- HY-P4746
-
|
|
Bacterial
|
Infection
|
|
LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance .
|
-
- HY-P4747
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
LL-37 GKE is an active domain of LL-37. LL-37 GKE has antibacterial activity and has potential applications in antibiotics .
|
-
- HY-P5823
-
|
|
nAChR
|
Neurological Disease
|
|
Azemiopsin is a potent nicotinic acetylcholine receptor (nAChR) inhibitor with IC50s of 0.18 μM and 22 μM against T. californica nAChR and human α7 nAChR, respectively. Azemiopsin blocks acetylcholine-induced currents in Xenopus oocytes heterologously expressing human muscle-type nAChR .
|
-
- HY-P5876
-
|
ProADM N20(bovine, porcine); PAMP-20(bovine, porcine)
|
nAChR
|
Neurological Disease
|
|
Proadrenomedullin (N-20) (ProADM N20) (bovine, porcine) is a potent and noncompetitive hypotensive and catecholamine release-inhibitory peptide released from chromaffin cells. Proadrenomedullin (N-20) (bovine, porcine) inhibits catecholamine secretion with an IC50 of 350 nM in PC12 pheochromocytoma cells. Proadrenomedullin (N-20) (bovine, porcine) also blocks (EC50≈270 nM) nicotinic cholinergic agonist desensitization of catecholamine release, as well as desensitization of nicotinic signal transduction ( 22Na + uptake) .
|
-
- HY-P5077
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
-
- HY-P5546
-
|
|
Bacterial
|
Infection
|
|
Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-256 μg/mL for methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection
|
-
- HY-P5547
-
|
|
Bacterial
|
Infection
|
|
Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection
|
-
- HY-P4984
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
|
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) is a T cell proliferation activator. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) promotes the in vitro proliferation of human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) can be used in research on inflammatory and immunity, as well as cancer .
|
-
- HY-P5011
-
-
- HY-P5616
-
|
|
Bacterial
|
Infection
|
|
Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively .
|
-
- HY-P5619
-
|
|
Bacterial
|
Infection
|
|
Maximin H3 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H3 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 20, 10, 20, 5 μg/ml, respectively .
|
-
- HY-P5684
-
|
|
Bacterial
|
Infection
|
|
Maximin H39 is an antimicrobial peptide. MaximinH39 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 9.4, 9.4, 18.8 μg/mL). Maximin H39 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P1025A
-
-
- HY-P10228
-
|
|
Fungal
Bacterial
|
Infection
|
|
S-Thanatin is an insect antimicrobial peptide with potent broad-spectrum antibacterial activity. S-Thanatin can inhibit the activity of Gram-negative bacteria, Gram-positive bacteria, and fungi, without cytotoxicity. The antibacterial activity of S-Thanatin is not affected by PH value, but monovalent cations (Na +/K +) can reduce its antibacterial activity against Gram-negative bacteria in a dose-dependent manner .
|
-
- HY-P10413
-
|
|
Androgen Receptor
|
Metabolic Disease
Endocrinology
|
|
SHBG 141-161 is a GPRC6A receptor agonist. SHBG 141-161 mimics the action of GPRC6A endogenous agonist uncarboxylated osteocalcin by binding to GPRC6A and promoting downstream signaling to increase testosterone and insulin secretion. SHBG 141-161 also reduces the affinity of GPRC6A to GDP protein by binding to the outer cell domain of GPRC6A thus affecting the dynamics of signal transduction. SHBG 141-161 can be used to study GPRC6A in energy metabolism and endocrine regulation .
|
-
- HY-P5077A
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
Guanylin (mouse, rat) TFA, a petide, is composed of 15 amino acids. Guanylin (mouse, rat) TFA is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) TFA can be used for the research of diarrhea .
|
-
- HY-P10636
-
|
|
LRRK2
|
Others
|
|
Nictide is a peptide substrate of LRRK2 (leucine-rich repeat protein kinase-2). Nictide can be phosphorylated by the activated LRRK2[G2019S] with a Km of 10 μM .
|
-
- HY-P1037
-
|
|
Motilin Receptor
|
Others
|
|
Motilin (26-47), human, porcine is an endogenous motilin receptor ligand with Ki and EC50 of 2.3 nM and 0.3 nM in a Chinese hamster ovary cell line.
|
-
- HY-P1541
-
|
Motilin (canine)
|
Motilin Receptor
|
Metabolic Disease
|
|
Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
|
-
- HY-P1568
-
|
Flagellin 22
|
Bacterial
|
Infection
|
|
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae .
|
-
- HY-P1840
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
|
Galanin Receptor Ligand M35 is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
-
- HY-P1840A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
|
Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
-
- HY-P2247
-
|
|
JNK
|
Cancer
|
|
JTP10-△-R9 TFA is a selective JNK2 peptide inhibitor, with an IC50 of 89 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3 .
|
-
- HY-P1562A
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 TFA is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM .
|
-
- HY-P2277
-
-
- HY-P1562
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
|
-
- HY-P3143
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50?of 7.68?nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST?and SPR assays, respectively.?BMSpep-57?facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P3143A
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68?nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
-
- HY-P3557
-
-
- HY-P5282
-
|
|
Acyltransferase
|
Others
|
|
ApoA-I mimetic peptide (PVLDLFRELLNELLEALKQKLK) has good lecithin:cholesterol acyl transferase (LCAT) activation potency. ApoA-I mimetic peptide can be used for synthesis of peptide/lipid complex .
|
-
- HY-P2277A
-
-
- HY-P5325F
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99), FAM labeled is a biological active peptide. (This is a 5-FAM-labeled Bid BH3 HY-P5325 peptide.)
|
-
- HY-106323
-
|
KW-5139
|
Motilin Receptor
|
Metabolic Disease
|
|
[Leu13]-Motilin (KW-5139) is a motilin analogue. [Leu13]-Motilin stimulates gastrointestinal motility in the rabbit. [Leu13]-Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro .
|
-
![[Leu13]-Motilin](//file.medchemexpress.eu/product_pic/hy-106323.gif)
- HY-P1162
-
-
- HY-P2064
-
|
|
Bacterial
|
Infection
|
|
Lariatins is a novel anti-mycobacterial peptides with a lasso structure produced by Rhodococcus jostii K01-B0171 .
|
-
- HY-P5655
-
|
|
Bacterial
|
Infection
|
|
Maximin H4 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H4 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 12, 6, 12, 6 μg/ml, respectively .
|
-
- HY-P3557A
-
-
- HY-P3176
-
|
|
Motilin Receptor
|
Others
|
|
Motilin, human, porcine is a gastrointestinal hormone, which is released during fasting and after eating, or by drinking water. Motilin, human, porcine promotes enteric cholinergic activity in human stomach with an EC50 of 33 nM, and thus modulates gastrointestinal motility function .
|
-
- HY-P10316
-
|
Calmodulin-Dependent Protein Kinase I (299-320) Binding Domain
|
CaMK
|
Others
|
|
CaMKI (299-320) refers to a peptide consisting of residues 299-320 of Calcium/calmodulin-dependent protein kinase I (CaMKI). CaMKI (299-320), as a protein kinase, has a high affinity interaction with Ca 2+-CAM (Kd≤1 nM≤1 nM), which can phosphorylate specific substrate proteins, thereby regulating their activity. CaMKI (299-320) contains the CAM-binding domain and the self-inhibition domain, and CaMKI (299-320) can be used to study cell physiological processes, including cell proliferation, differentiation, and apoptosis .
|
-
- HY-17584A
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
-
- HY-P10499
-
|
|
CaMK
|
Others
|
|
[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) is a modified fragment of calcium/calmodulin-dependent protein kinase II that contains the active domain of CaMKII and has an alanine substitution at position 286. [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) can be used to develop more potent CaMKII inhibitors .
|
-
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)](//file.medchemexpress.eu/product_pic/hy-p10499.gif)
- HY-P10779
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
flg22Pst is a peptide that can be derived Pseudomonas syringae pv. tabaci and serves as an effective elicitor for the plant immune system. flg22Pst can induce callose deposition in plants, trigger plant immune responses, and thereby assist plants in defending against pathogen invasion .
|
-
- HY-P10796
-
|
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
YARA peptide, a cell-penetrating peptide, is a MK2 inhibitor. YARA-loaded nanoparticles decreases the levels of inflammatory cytokines (IL-1β, IL-6, and TNF-α) in an ex vivo skin culture model. YARA peptide is promising for research of atopic dermatitis (AD) .
|
-
- HY-P0270
-
|
Magainin II
|
Bacterial
Antibiotic
Fungal
|
Infection
|
|
Magainin 2 (Magainin II) is an?antimicrobial?peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa . Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes .
|
-
- HY-P3965A
-
-
- HY-P4895
-
|
|
Oxytocin Receptor
|
Neurological Disease
|
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
-
- HY-P5827
-
-
- HY-P0041
-
-
- HY-P0041A
-
-
- HY-P10104
-
|
|
Caspase
|
Cancer
|
|
Smac-N7, Penetratin conjugated is a caspase activator derived from the second mitochondria-derived activator of caspases (SMAC) .
|
-
- HY-159191S
-
-
- HY-P0256
-
Apamin
4 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
-
- HY-P1753
-
|
|
HIV
|
Infection
|
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
-
- HY-P1817
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP-38 (16-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production . PACAP is a potent activator of cAMP formation .
|
-
- HY-P1306
-
|
|
GHSR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Obestatin(rat), encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) has anti-inflammatory, anti-myocardial infarction and antioxidant activities .
|
-
- HY-P1306A
-
|
|
GHSR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Obestatin(rat) TFA, encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) TFA suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) TFA has anti-inflammatory, anti-myocardial infarction and antioxidant activities .
|
-
- HY-P3499
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
|
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
-
- HY-P1130
-
|
Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
M871 (Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide) is a selective galanin receptor type 2 (GalR2) antagonist. M871 exhibits Ki values of 13.1 nM and 420 nM for GalR2 and GalR1, respectively. M871 can be used for research on GalR2-related diseases (such as epilepsy, pain) .
|
-
- HY-P5601
-
|
|
Bacterial
Fungal
|
Infection
|
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P0142
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
|
|
DT-3 is a membrane-permeable protein kinase G Iα inhibitory peptide. DT-3 is a guanylyl cyclase? inhibitor and shows pharmacological blockade of the cGMP–PKG signalling .
|
-
- HY-P3275
-
|
Aβ(17-40)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (17-40) (Aβ(17-40)) is a fragment of Amyloid-β peptide that has shown neurotoxic activities in SH-SY5Y and IMR-32 cells. β-Amyloid (17-40) can be used for the research of neurological disease .
|
-
- HY-P10152
-
|
|
Biochemical Assay Reagents
|
Infection
|
|
INF7 is a derivative of the N-terminal domain of the HA2 protein that can be used to enhance the endosomal escape of polyplexes or liposome-encapsulated proteins .
|
-
- HY-P5601A
-
|
|
Bacterial
Fungal
|
Infection
|
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
-
- HY-P10242
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 can be used for researches of muscle atrophic disorders .
|
-
- HY-P10372
-
|
|
Src
|
Cancer
|
|
pFYN peptide is a biotin-labled phosphorylated peptide substrate derived from FYN (a Src family kinase) .
|
-
- HY-P10718
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
IMG-2005 is a TLR signaling pathway inhibitor. IMG-2005 mimics the Toll/interleukin-1 receptor (TIR) domain of MyD88, thereby preventing its homodimerization, which causes damage to tracheal epithelial cells and triggers pulmonary immune diseases .
|
-
- HY-P10242A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 TFA is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 TFA inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 TFA can be used for researches of muscle atrophic disorders .
|
-
- HY-P1480
-
-
- HY-P1949A
-
|
|
CXCR
|
Cardiovascular Disease
Cancer
|
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
-
- HY-P2249
-
|
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
-
- HY-P1112
-
-
- HY-P1112A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
-
- HY-P2468
-
|
BADBH3 103-127 (human); BADBH3 (human)
|
Bcl-2 Family
|
Cancer
|
|
BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL. BAD (103-127) (human) is reported to have almost 800-fold higher affinity for Bcl-XL than the 16-mer peptide .
|
-
- HY-P2551
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Biotin-β-Amyloid (17-40) is a N-terminal-labelled biotinylated amyloid-?-(1-40) peptide. β-Amyloid (17-40) is a 24-residue fragment of the Aβ protein via?post-translational processing of amyloid precursor protein (APP) .
|
-
- HY-P1949
-
|
|
CXCR
|
Cardiovascular Disease
Cancer
|
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
-
- HY-P4352
-
|
|
HIV
|
Others
|
|
HIV-2 Peptide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4805
-
-
- HY-P4697
-
-
- HY-P5615
-
|
|
Bacterial
|
Infection
|
|
XT-2 peptide is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-2 peptide has strong activity against E.coli, the vaule of MIC is 8 μM .
|
-
- HY-P1011
-
-
- HY-P10446
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445). TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can disrupt the interaction between the breast cancer oncogene BRD4/JMJD6 and inhibit the growth of breast cancer cells. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
-
- HY-P10471
-
|
MARCKS-ED
|
MARCKS
PKC
|
Others
|
|
MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
-
- HY-P10471A
-
|
MARCKS-ED TFA
|
MARCKS
PKC
|
Others
|
|
MPSD TFA (MARCKS-ED TFA) is the TFA salt form of MPSD (HY-P10471). MPSD TFA is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD TFA can sense membrane curvature and recognize phosphatidylserine. MPSD TFA can be utilized as biological probe to study membrane shape and lipid composition .
|
-
- HY-P10476
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 can be used for researches of muscle atrophic disorders .
|
-
- HY-P5765
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin (1-13)-spantide I is a chimeric peptide composed of the N-terminal fragment of galanin (amino acids 1-13) and spantide, a known substance P receptor antagonist. Galanin (1-13)-spantide I has a high affinity for spinal galanin receptor (Kd=1.16 nM). Galanin (1-13)-spantide I can be used to study the effects of galanin on feeding behavior .
|
-
- HY-P4697A
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
pTH (44-68) (human) TFA is a fragment of human parathyroid hormone (pTH) that lacks the adenylate cyclase-stimulating activity of intact pTH. pTH (44-68) (human) TFA can be used to study the mechanism of action of pTH .
|
-
- HY-P10476A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) TFA is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 TFA can be used for researches of muscle atrophic disorders .
|
-
- HY-P1098
-
Ac2-26
4 Publications Verification
|
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
-
- HY-P1098A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 TFA, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
-
- HY-P1782
-
-
- HY-P1889A
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV TFA is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins .
|
-
- HY-P2499
-
|
|
Bcl-2 Family
|
Cancer
|
|
BAD (103-127) (human), FAM-labeled is a FAM-labeled human BAD (103-127) (HY-P2468). BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL .
|
-
- HY-P5003
-
|
|
MMP
|
Inflammation/Immunology
|
|
Collagen Type II Fragment is an anti-inflammatory peptide that potently inhibits collagen-induced arthritis (CIA) in mice. Collagen Type II Fragment can be used for research on inflammation and immunity .
|
-
- HY-P1098B
-
|
|
IKK
|
Inflammation/Immunology
|
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
-
- HY-P5984
-
|
|
mTOR
|
Others
|
|
Thioether-cyclized helix B peptide, CHBP can improve metabolic stability and renoprotective effect through inducing autophagy via inhibition of mTORC1 and activation of mTORC2 .
|
-
- HY-P5984A
-
|
|
mTOR
|
Others
|
|
Thioether-cyclized helix B peptide, CHBP (TFA) is the TFA form of Thioether-cyclized helix B peptide, CHBP (HY-P5984). Thioether-cyclized helix B peptide, CHBP (TFA) can improve metabolic stability and renoprotective effect through inducing autophagy via inhibition of mTORC1 and activation of mTORC2 .
|
-
- HY-P10115
-
|
|
STAT
|
Cancer
|
|
APT STAT3 is a specific STAT3-binding peptide. APT STAT3 can bind STAT3 with high specificity and affinity (～231 nmol/L). APT STAT3 is a tractable agent for translation to target the broad array of cancers harboring constitutively activated STAT3 .
|
-
- HY-P10409
-
|
Small humanin-like peptide 2
|
Apoptosis
|
Others
|
|
SHLP2 (Small humanin-like peptide 2) is a small molecule peptide encoded by mitochondrial DNA, belonging to mitochondria derived peptide. SHLP2 has the activity of regulating apoptosis and inhibits cell death. SHLP2 can be used in the study of diseases related to mitochondrial dysfunction and anti-aging diseases .
|
-
- HY-P0175
-
740 Y-P
Maximum Cited Publications
158 Publications Verification
740YPDGFR; PDGFR 740Y-P
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P (740YPDGFR; PDGFR 740Y-P) is a potent and cell-permeable PI3K activator. 740 Y-P readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone .
|
-
- HY-P1567
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
|
-
- HY-P1210
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
-
- HY-P1210A
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
-
- HY-P0175A
-
|
740YPDGFR TFA; PDGFR 740Y-P TFA
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone .
|
-
- HY-P5492
-
|
Delta-lysin
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin is a model in the study of peptides interacting with membranes. Delta-hemolysin is poorly active against bacteria .
|
-
- HY-P5658
-
|
|
Bacterial
|
Infection
|
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
-
- HY-P10074
-
|
|
ERK
|
Inflammation/Immunology
|
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
-
- HY-P5492A
-
|
Delta-lysin TFA
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin) TFA, a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin TFA may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin TFA is a model in the study of peptides interacting with membranes. Delta-hemolysin TFA is poorly active against bacteria .
|
-
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
-
- HY-P10279
-
|
Human atrial natriuretic factor (102–126)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
Others
|
|
Anaritide is a synthetic form of atrial natriuretic peptide (ANP) composed of 25 amino acids. Anaritide increases glomerular filtration rate by dilating into and contracting out the bulbar arterioles. Anaritide can be used to study the effects on patients with acute tubular necrosis, particularly in improving dialysis free survival .
|
-
- HY-P1223
-
-
- HY-P1468
-
|
Amyloid β-Protein (1-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
-
- HY-P1546
-
|
|
Bacterial
|
Infection
|
|
Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.
|
-
- HY-106302
-
|
Moli1901; Lancovutide
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Duramycin (Moli1901) is a lantibiotic derived from Streptomyces cinnamoneuma. Duramycin also is a antimicrobial peptide. Duramycin can be used for the research of cystic fibrosis (CF) .
|
-
- HY-P4195
-
|
|
IPK Superfamily
|
Metabolic Disease
|
|
[K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
-
![[K15,R16,L27]VIP(1-7)/GRF(8-27)](//file.medchemexpress.eu/product_pic/hy-p4195.gif)
- HY-P5465
-
|
|
Bacterial
|
Others
|
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
-
- HY-P2281
-
-
- HY-P5604
-
|
|
Bacterial
|
Infection
|
|
Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5605
-
|
|
Bacterial
|
Infection
|
|
Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 2 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5608
-
|
|
Bacterial
|
Infection
|
|
Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 4 has cytotoxicity on tumor cells and spermicidal effect .
|
-
- HY-P5611
-
|
|
Bacterial
|
Infection
|
|
Maximin 7 is an antimicrobial peptide derived from toad Bombina maxima .
|
-
- HY-P5580
-
|
|
Bacterial
|
Infection
Cancer
|
|
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (MIC: 1.3, 2.3, 5.0, 2.6, 2.3 μM for S. aureus, P. aeruginosa, P. aeruginosa, E. (ATCC 25922), E. (54127) respectively). Dermaseptin-B3 also inhibits tumor cell proliferation .
|
-
- HY-P5621
-
|
|
Bacterial
|
Infection
|
|
Maximin 63 is an antimicrobial peptide derived from the brain of a toad. Maximin 63 has strong activity against S.aureus (MIC: 18.8 μg/mL) .
|
-
- HY-P5636
-
|
BLP-7; Maximin 6
|
Bacterial
|
Infection
|
|
Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis .
|
-
- HY-P5666
-
|
|
Bacterial
|
Infection
|
|
Maximin 15 is an antimicrobial peptide derived from the toad brain. Maximin 15 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 9.4, 18.8, 75 μg/mL, respectively .
|
-
- HY-P5668
-
|
|
Bacterial
|
Infection
|
|
Maximin 28 is an antimicrobial peptide derived from the toad brain. Maximin 28 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 4.7, 9.4, 75 μg/mL, respectively .
|
-
- HY-P5672
-
|
|
Bacterial
|
Infection
|
|
Maximin 39 is an antimicrobial peptide derived from the toad brain. Maximin 39 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 18.8, 37.5 μg/mL, respectively .
|
-
- HY-P5685
-
|
|
Bacterial
|
Infection
|
|
Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells .
|
-
- HY-P5612
-
-
- HY-P4195A
-
|
|
IPK Superfamily
|
Metabolic Disease
|
|
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
-
![[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate](//file.medchemexpress.eu/product_pic/hy-p4195a.gif)
- HY-P10058
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
cpm-1285m is a cell-permeable mutated peptide analogue of cpm-1285 (Bcl-2 inhibitory peptide). cpm-1285m contains a single substitution of alanine for Leu-151, and exhibits a decrease in Bcl-2 binding affinity with a reduction in IC50 of ∼15-fold. cpm-1285m can be used as a control of cpm-1285 .
|
-
- HY-P10057
-
|
|
Apoptosis
|
Cancer
|
|
cpm-1285 induces apoptosis by functionally blocking intracellular Bcl-2 and related death antagonists. cpm-1285 shows strong binding potency to Bcl-2 with an IC50 value of 130 nM. cpm-1285 reduces tumor burden in mice .
|
-
- HY-P10387
-
|
|
METTL3
Apoptosis
|
Cancer
|
|
RSM3, a stapled peptide, is a METTL3-METTL14 inhibitor with an Kd of 3.10 μM. RSM3 inhibits tumor growth while induces cell apoptosis. RSM3 can be used for study of cancer .
|
-
- HY-P10387A
-
|
|
METTL3
Apoptosis
|
Cancer
|
|
RSM3 TFA, a stapled peptide, is a METTL3-METTL14 inhibitor with an Kd of 3.10 μM. RSM3 TFA inhibits tumor growth while induces cell apoptosis. RSM3 TFA can be used for study of cancer .
|
-
- HY-P10703
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p2 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10702) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p2 is promising for the development of nanomaterials in the biomedical field .
|
-
- HY-P10702
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p1 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10703) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p1 is promising for the development of nanomaterials in the biomedical field .
|
-
- HY-P0091
-
|
Thymosin α1
|
Influenza Virus
|
Cancer
|
|
Thymalfasin is an immunomodulating agent able to enhance the Thl immune response.
|
-
- HY-P0082
-
|
Glucagon
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-P1339
-
-
- HY-P1511
-
-
- HY-P1339A
-
-
- HY-P1874
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II) .
|
-
- HY-P0082A
-
|
Glucagon hydrochloride
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation .
|
-
- HY-P1340
-
|
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
[Ala11,D-Leu15]-Orexin B(human) is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
-
![[Ala11,D-Leu15]-Orexin B(human)](//file.medchemexpress.eu/product_pic/hy-p1340.gif)
- HY-P1340A
-
|
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
[Ala11,D-Leu15]-Orexin B(human) TFA is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) TFA shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
-
![[Ala11,D-Leu15]-Orexin B(human) TFA](//file.medchemexpress.eu/product_pic/hy-p1340a.gif)
- HY-P1143
-
|
|
GCGR
|
Metabolic Disease
|
|
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes .
|
-
![[Des-His1,Glu9]-Glucagon amide](//file.medchemexpress.eu/product_pic/hy-p1143.gif)
- HY-P1143A
-
|
|
GCGR
|
Metabolic Disease
|
|
[Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA is potentially useful in the study of the pathogenesis of diabetes .
|
-
![[Des-His1,Glu9]-Glucagon amide TFA](//file.medchemexpress.eu/product_pic/hy-p1143a.gif)
- HY-P5894
-
|
Galanin-like peptide (3-32)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
human GALP (3-32) (Galanin-like peptide (3-32)) is a potent galanin receptor agonist with high affinity for both GalR1 (IC50=33 nM) and GalR2 (IC50=15 nM) in a competitive binding study. human GALP (3-32) exhibits the high potency in altering the extracellular acidification rate of SH-SY5Y cells transfected with GalR2 (EC50=360 nM) .
|
-
- HY-P1468F
-
|
Biotin-amyloid β-protein (1-28)
|
Amyloid-β
|
Others
|
|
Biotin-β-amyloid (1-28) (Biotin-amyloid β-protein (1-28)) is abiotinylated β-Amyloid (1-28) (HY-P1468).
|
-
- HY-P5552
-
|
|
Bacterial
Parasite
Fungal
|
Infection
|
|
Melimine is a hybrid antimicrobial peptide of Melittin (HY-P0233) and Protamine. Melimine is active against P. aeruginosa and S. aureus. Melimine has broad spectrum activity against bacteria, fungi and protozoa .
|
-
- HY-P5587
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P10006
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Leumorphin, human is a potent kappa opioid receptor (κ opioid receptor) agonist. Leumorphin, human inhibits the contraction of the myenteric plexus-longitudinal muscle preparation of the guinea pig ileum .
|
-
- HY-P10080
-
-
- HY-P10138
-
-
- HY-P10138A
-
-
- HY-P10375
-
-
- HY-P1155
-
|
rGHRH(1-29)NH2
|
GHSR
|
Cancer
|
|
GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
|
-
- HY-P1225
-
-
- HY-P4108
-
|
|
Influenza Virus
|
Infection
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
-
- HY-P1468F1
-
|
5-FAM-Amyloid β-protein (1-28)
|
Amyloid-β
|
Others
|
|
5-FAM-β-Amyloid (1-28) is afluorescently labeled β-Amyloid (1-28) (HY-P1468).
|
-
- HY-P4969
-
-
- HY-P5590
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S3 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5792
-
|
ANP (3-28) (human)
|
Endothelin Receptor
|
Cardiovascular Disease
Metabolic Disease
|
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
-
- HY-P5074
-
|
|
GCGR
|
Metabolic Disease
|
|
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets .
|
-
- HY-P10260
-
-
- HY-P10301
-
|
|
CXCR
|
Cancer
|
|
CXCL9(74-103) is a derivative peptide of CXCL9 that has a high affinity for glycosaminoglycans (GAGs) and can bind to GAGs. CXCL9(74-103) possesses anti-angiogenic properties, capable of reducing EGF, VEGF165, and FGF-2-mediated angiogenesis processes in vitro, without exhibiting cytotoxicity .
|
-
- HY-P10553
-
|
|
Apoptosis
|
Cancer
|
|
ARF(26–44), cell-permeable is a cell-penetrating peptide derived from a specific amino acid sequence of the p14ARF tumor suppressor protein. As a functional inhibitor of FoxM1, ARF(26–44) cell-permeable shows significant anti-tumor activity in the treatment of mouse hepatocellular carcinoma (HCC), significantly increasing tumor cell apoptosis and reducing tumor cell proliferation and angiogenesis. ARF(26–44), cell-permeable can be used in research on tumor therapy .
|
-
- HY-P6441
-
|
|
β-catenin
Wnt
|
Inflammation/Immunology
|
|
KP-6, a polypeptide, is a Wnt/β-catenin signal inhibitor. KP-6 inhibits TGF-β and blocks rush fibrosis signal path crucial in vivo. KP-6 suppresses Renal tissues damage and renal fibrosis, and reverse the course of disease of chronic kidney disease (CKD) .
|
-
- HY-P1556
-
|
|
PKG
|
Cardiovascular Disease
|
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P2080
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide,human is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P2080B
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P2317
-
|
|
Bacterial
Endogenous Metabolite
|
Infection
|
|
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection .
|
-
- HY-P2541
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
-
- HY-P2541A
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
-
- HY-P1556A
-
|
|
PKG
|
Metabolic Disease
|
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
-
- HY-P4672
-
|
|
GCGR
|
Metabolic Disease
|
|
(Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .
|
-
- HY-P4405
-
|
|
GHSR
|
Endocrinology
|
|
(D-Ala2)-GRF (1-29) amide (human) is a superagonist of GRF, exhibiting extremely high GH-releasing activity about 50 times that of GRF (1-29) in both pigs and rats .
|
-
- HY-P4751
-
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
-
- HY-P2080C
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30)-Myr is the Myr-modified GIP (1-30), which is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
-
- HY-P4966
-
-
- HY-P5585
-
|
|
Bacterial
|
Infection
|
|
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor .
|
-
- HY-P10267
-
|
|
Bombesin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord. , and may exhibit activity in stimulating smooth-muscle. Neuromedin B causes local vasodilation, increases vascular permeability and local hyperalgesia, thereby participating in neurogenic inflammation. Neuromedin B regulates appetite, body temperature, and behavioral responses to stress. Neuromedin B is also involved in regulating smooth muscle contraction and secretory function in the gastrointestinal tract .
|
-
- HY-P0264
-
|
Avexitide
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH) .
|
-
- HY-P1471
-
|
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P1235
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-P1236
-
|
Atrial natriuretic factor (1-28) (rat, mouse)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P1520
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P1235A
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
-
- HY-P0069A
-
-
- HY-P1236A
-
|
Atrial natriuretic factor (1-28) (rat, mouse) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
-
- HY-P1471A
-
|
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
-
- HY-P1520A
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
-
- HY-P0211
-
|
|
GCGR
|
Cardiovascular Disease
|
|
[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human), a growth hormone releasing factor (GRF) analogue, is a vasoactive intestinal peptide (VIP) antagonist .
|
-
![[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human)](//file.medchemexpress.eu/product_pic/hy-p0211.gif)
- HY-P4750
-
|
|
GHSR
|
Endocrinology
|
|
Acetyl-(D-Arg2)-GRF (1-29) amide (human) is an antagonist of growth hormone releasing factor (GRF). Acetyl-(D-Arg2)-GRF (1-29) amide (human) inhibits the release of growth hormone (GH) and can be used for endocrine research .
|
-
- HY-P4874
-
|
|
Melanocortin Receptor
|
Metabolic Disease
|
|
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity .
|
-
- HY-P3709A
-
|
|
p62
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide TFA is a specific TRAF6-p62 inhibitor. TRAF6 peptide TFA potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide TFA has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke .
|
-
- HY-P4870
-
-
- HY-120521
-
-
- HY-P5568
-
|
|
HIV
|
Infection
|
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
-
- HY-P3508A
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-27 acetate, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 acetate is an anticancer peptide. PNC-27 acetate can be used in acute myeloid leukemia research .
|
-
- HY-P0264A
-
|
Avexitide acetate
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research .
|
-
- HY-P2491
-
|
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
-
- HY-P3304
-
|
|
GHSR
|
Neurological Disease
Cancer
|
|
MR 409 is a selected growth hormone-releasing hormone (GHRH) agonist. MR 409 has remarkable neuroprotective effects through enhancing endogenous neurogenesis in cerebral ischemic mice. MR 409 also inhibits the in vivo growth of lung cancer .
|
-
- HY-P5307
-
|
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
|
-
- HY-P5014
-
-
- HY-P10076
-
|
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
-
- HY-P10325
-
-
- HY-P10438
-
|
|
Raf
|
Cancer
|
|
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
-
- HY-P2150
-
|
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
-
- HY-P0069
-
|
AM-111; XG-102
|
JNK
|
Others
|
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
-
- HY-P0220
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
-
- HY-P0220A
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
-
- HY-P1867
-
-
- HY-P1021A
-
-
- HY-P1294A
-
|
|
CRFR
|
Neurological Disease
|
|
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM .
|
-
- HY-P4071
-
|
Cathelicidin-OH antimicrobial peptide
|
Bacterial
|
Infection
|
|
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra) .
|
-
- HY-P4720
-
|
|
Interleukin Related
|
Inflammation/Immunology
Cancer
|
|
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis .
|
-
- HY-P5205
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakA is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakB, and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS, GakA with GakB, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
-
- HY-P4855
-
|
|
Fungal
Bacterial
|
Infection
|
|
CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections .
|
-
- HY-P5593
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
-
- HY-P5084
-
-
- HY-P10238
-
|
|
Apoptosis
|
Cancer
|
|
MYBMIM is an inhibitor for assembly of the molecular MYB:CBP/P300 complex. MYBMIM inhibits growth of leukemia cells .
|
-
- HY-P5829A
-
|
|
Bacterial
|
Infection
|
|
CRAMP (140-173) (mouse) TFA is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) TFA inhibits LPS (HY-D1056)-induced responses, and can not colocalized with TLR3 in BEAS-2B cells .
|
-
- HY-169235
-
-
- HY-P1021
-
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
-
- HY-P3652
-
-
- HY-P4110
-
|
|
iGluR
|
Metabolic Disease
Inflammation/Immunology
|
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
-
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
-
- HY-P4159B
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159A
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4159
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
-
- HY-P4542
-
|
|
CRFR
|
Endocrinology
|
|
(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a CRF antagonist. (D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) prevents the IL-1a induced Luteinizing hormone (LH) inhibition .
|
-
- HY-P5878
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
RG33 Peptide is a diabetes inhibitor that significantly improves glucose clearance in insulin-resistant mice. RG33 Peptide effectively solubilizes lipid vesicles and promotes cholesterol efflux in cultured macrophages. RG33 Peptide is used in research into type 2 diabetes (T2D) .
|
-
- HY-P4704
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-95) (human) is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
-
- HY-P4704A
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-95) (human) TFA is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) TFA can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
-
- HY-P1231
-
-
- HY-P1519
-
|
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
- HY-P1519B
-
|
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
-
- HY-P1064A
-
|
|
HIV
Apelin Receptor (APJ)
|
Infection
Cardiovascular Disease
Metabolic Disease
|
|
Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ .
|
-
- HY-P1064
-
|
|
Apelin Receptor (APJ)
HIV
|
Infection
Cardiovascular Disease
Metabolic Disease
|
|
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ .
|
-
- HY-P2497
-
|
|
GCGR
|
Neurological Disease
|
|
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats .
|
-
- HY-P5871
-
|
JzTx-XII
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
-
- HY-P5785
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P5982
-
|
|
Phosphatase
|
Neurological Disease
|
|
PTPσ Inhibitor, ISP can bind to recombinant human PTPs and inhibits PTPσ signaling. PTPσ Inhibitor, ISP can penetrate the membrane and relieves the chondroitin sulfate proteoglycan (CSPG)-mediated axonal sprouting inhibition in spinal cord injury model. PTPσ Inhibitor, ISP enhances remyelination in LPC-induced demyelinated spinal cord. PTPσ Inhibitor, ISP also promotes oligodendrocyte progenitor cells (OPCs) migration, maturation, remyelination, and functional recovery in animal models of Multiple Sclerosis (MS) .
|
-
- HY-P10079
-
-
- HY-P0007
-
|
Carbocalcitonin
|
Drug Intermediate
|
Metabolic Disease
|
|
Elcatonin (Carbocalcitonin) is a synthetic analog of eel calcitonin. Elcatonin increases bone mineral density, inhibits bone resorption and processes a central analgesic effect .
|
-
- HY-P5785A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
-
- HY-P10379
-
|
|
Neuropeptide FF Receptor
|
Others
Neurological Disease
|
|
palm-PrRP31 is a potent dual receptor agonist for both GPR10 (EC50=72 pM) and NPFF-R2. palm-PrRP31 activates downstream signaling pathways through binding to its receptors, GPR10 and NPFF-R2, which results in reduced appetite and increased energy expenditure. Utilizing palm-PrRP31 facilitates the study of the mechanism of action in the nervous system, thereby elucidating the complex biological processes that regulate appetite and energy expenditure .
|
-
- HY-P10516
-
|
|
DNA/RNA Synthesis
RAD51
|
Cancer
|
|
BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence .
|
-
- HY-P5871A
-
|
JzTx-XII TFA
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
-
- HY-P1532
-
-
- HY-P1222
-
|
|
Bacterial
|
Infection
|
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P1222A
-
|
|
Bacterial
|
Infection
|
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
|
-
- HY-P1513A
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
-
- HY-P2283
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-37) (human) correlates moderately with Mini-Mental State Examination (MMSE) scores in Alzheimer disease. β-Amyloid (1-37) (human) possesses an added diagnostic value .
|
-
- HY-P1424A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
-
- HY-P1424
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
-
- HY-P3769
-
|
|
Guanylate Cyclase
|
Cardiovascular Disease
|
|
Prepro-ANF (56-92), human is a human atrial natriuretic factor precursor. Prepro-ANF (56-92), human is also a guanylate cyclase activator that enhances particulate guanylate cyclase activity in the renal membrane and renal unit .
|
-
- HY-P5327
-
|
|
Bcl-2 Family
|
Others
|
|
r8 Bid BH3 is a biological active peptide. (The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.)
|
-
- HY-P5836
-
|
|
Interleukin Related
Bacterial
Enterovirus
|
Inflammation/Immunology
|
|
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B .
|
-
- HY-P5837
-
|
|
Interleukin Related
Enterovirus
|
Inflammation/Immunology
|
|
Citrullinated LL-37 2cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 2cit reduces LL-37 activity against HRV at 10 μg/mL and reduces the antibacterial effect of LL-37. Citrullinated LL-37 2cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B. Citrullinated LL-37 2cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
-
- HY-P5838
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Citrullinated LL-37 5cit is a citrullinated LL-37 (HY-P1222) peptide. The antiviral and antibacterial effects of Citrullinated LL-37 5cit are significantly reduced compared to native LL-37. Citrullinated LL-37 5cit is unable to reduce LPS-mediated release of TNF-α due to a lack of LPS-binding capacity .
|
-
- HY-P5842
-
|
|
Bacterial
Influenza Virus
|
Infection
|
|
Citrullinated LL-37 3cit is a host defense peptide (HDP) with broad immunomodulatory and antimicrobial activities. Citrullinated LL-37 3cit exhibits direct antiviral effects against human rhinoviruses (HRV) .
|
-
- HY-P5843
-
|
|
Enterovirus
|
Infection
|
|
Citrullinated LL-37 3cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 3cit lacks all antiviral activity at 10 μg/mL and retains some activity against HRV at 30 μg/mL. Citrullinated LL-37 3cit reduces the immunomodulatory activity of LL-37. Citrullinated LL-37 3cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
-
- HY-P5873
-
|
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
-
- HY-P5739
-
|
|
Bacterial
|
Infection
|
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
-
- HY-P5772
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
-
- HY-P5773
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
-
- HY-P10377
-
|
|
Neuropeptide FF Receptor
|
Metabolic Disease
|
|
GUB03385 is a long-acting PrRP31 analogue. GUB03385 is a potent dual agonist for GPR10 (full agonist, EC50: 0.4 nM) and NPFF2R (partial agonist, EC50: 20 nM). GUB03385 has anti-obesity effect .
|
-
- HY-P10380
-
|
|
Neuropeptide FF Receptor
|
Neurological Disease
|
|
palm11-PrRP31 is a lipidized endogenous appetite inhibitory neuropeptide (PrRP) analogue. palm11-PrRP31 is GPR10 (EC50=39 pM) and NPFF-R2 effective dual agonists. palm11-PrRP31 is able to mimic the natural function of PrRP by binding to these receptors to reduce food intake. palm11-PrRP31 can be used as a potential anti-obesity agent and for the study of neuropeptide-receptor interaction .
|
-
- HY-P10631
-
|
|
HSP
|
Inflammation/Immunology
|
|
Gp96-II is a gp96-blocking peptide that antagonizes gp96-mediated LPS(HY-D1056)-induced cytokine production. Gp96-II can be utilized in research on inflammatory disease .
|
-
- HY-P1539
-
-
- HY-P2562
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease .
|
-
- HY-P3979
-
|
HNP 4
|
Bacterial
|
Infection
|
|
Defensin HNP 4 (HNP 4) is a single 11 amino acid long fragment of HNP-41-11. Defensin HNP 4 has inhibitory effect against multidrug-resistant and non-resistant strains .
|
-
- HY-P4744
-
|
|
Bacterial
|
Infection
Cancer
|
|
LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research .
|
-
- HY-P0221B
-
|
|
PACAP Receptor
|
Endocrinology
|
|
PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
-
- HY-P0221C
-
|
|
PACAP Receptor
|
Endocrinology
|
|
PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
-
- HY-P3688
-
|
Aβ (1-38); Aβ38
|
Amyloid-β
|
Others
|
|
β-Amyloid (1-38) (Aβ (1-38); Aβ38) is aAβ Fragment.
|
-
- HY-P4865
-
-
- HY-P4894
-
-
- HY-P4885
-
|
AβpE3-40
|
Amyloid-β
|
Neurological Disease
|
|
Glp-Amyloid-β (3-40) Peptide (human) (AβpE3-40) is a minor amounts of pyroglutamate-modified Aβ isolated from from 24-month-old Amyloid precursor protein (APP) transgenic Mice .
|
-
- HY-P4744A
-
|
|
Bacterial
|
Infection
Cancer
|
|
LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used for cancer research .
|
-
- HY-P10262
-
-
- HY-P10306
-
|
|
Bacterial
|
Infection
|
|
Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials .
|
-
- HY-169232
-
|
|
PROTACs
|
Cancer
|
|
PCC16 chloride is a CRBN-based cp-PCC with an IC50 value of 102 nM for the degradation of DHHC3. PCC16 chloride has antitumor activity. (Target protein ligand: HY-169235, linker: HY-169236, E3 ligase ligand: HY-10984) .
|
-
- HY-P1157
-
-
- HY-P0221
-
|
Pituitary Adenylate Cyclase Activating Polypeptide 38
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
-
- HY-P0221A
-
|
Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
-
- HY-P1752
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II (human) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior .
|
-
- HY-P1752A
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, human (TFA) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior .
|
-
- HY-106373
-
|
ACTH; Adrenocorticotrophic hormone
|
Androgen Receptor
|
Endocrinology
|
|
Adrenocorticotropic hormone (ACTH) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production .
|
-
- HY-106373A
-
|
ACTH TFA; Adrenocorticotrophic hormone TFA
|
Androgen Receptor
|
Metabolic Disease
|
|
Adrenocorticotropic hormone (ACTH) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production .
|
-
- HY-P1211B
-
|
1-39-Corticotropin (human) (acetate)
|
Biochemical Assay Reagents
|
Others
|
|
Adrenocorticotropic Hormone (ACTH) (1-39), human acetate is a full length human adrenocorticotropic hormone .
|
-
- HY-107528
-
|
|
β-catenin
GSK-3
|
Cancer
|
|
FRATtide is a peptide derived from the GSK-3 binding protein that inhibits the phosphorylation of Axin and β-catenin. FRATtide inhibits GSK-3 binding to Axin .
|
-
- HY-P4868
-
-
- HY-P4892
-
-
- HY-P5007
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
|
Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the carboxyl terminus of the arginine vasopressin (AVP) precursor peptide. Copeptin (human) can be used in the study of cardiovascular disease .
|
-
- HY-P10526
-
|
|
Bacterial
|
Infection
|
|
CRAMP (1-39) is an antimicrobial peptide. CRAMP (1-39) has shown potent bactericidal effects against multiple strains of Neisseria meningitidis in vitro. CRAMP (1-39) can be used to study drug-resistant bacterial infections .
|
-
- HY-13443
-
-
- HY-13443A
-
-
- HY-P0265
-
-
- HY-P1387
-
|
|
Amyloid-β
Apoptosis
|
Neurological Disease
|
|
β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca 2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease .
|
-
- HY-106224
-
|
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
-
- HY-P1296
-
|
Urocortin (Rattus norvegicus); Rat urocortin
|
CRFR
|
Neurological Disease
Endocrinology
|
|
Urocortin, rat (Urocortin (Rattus norvegicus)) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively .
|
-
- HY-P1543
-
-
- HY-P2282
-
|
|
STAT
|
Cancer
|
|
APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity .
|
-
- HY-P0265A
-
|
Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease .
|
-
- HY-P2549
-
-
- HY-P2550
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled?β-Amyloid (1-40) peptide (λex=?492?nm and λem=?518?nm) .
|
-
- HY-P1427
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
-
- HY-P2550A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled TFA is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).
|
-
- HY-P4790
-
|
|
PI3K
Akt
|
Metabolic Disease
|
|
Acetyl-Exenatideyes is an acetylated derivative of Exenatide. Exenatide has the function similar to insulin, which can be used for research of type 2 diabetes. Exenatide can promote Th17 differentiation, inhibits Tregs differentiation, downregulates PI3K/Akt/FoxO1 phosphorylation .
|
-
- HY-P4886
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the amyloid template block in Alzheimer's disease. pEAβ(3-42) accelerated the aggregation of Aβ(1-42), while Aβ(1-42) significantly slowed the primary and secondary nucleation of pEAβ(3-42) .
|
-
- HY-P4882
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits .
|
-
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P2609F
-
|
|
PACAP Receptor
|
Others
|
|
PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221)
|
-
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
-
- HY-P5370
-
|
|
Amyloid-β
|
Others
|
|
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
|
-
- HY-P4882A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits .
|
-
- HY-P5906
-
|
Citrullinated Aβ (1-40); Citrullinated Aβ40
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P0265) with a citrullination at the Arg5 site. Citrullinated amyloid-β (1-40) peptide (human) exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified β-Amyloid (1-40) .
|
-
- HY-P5057
-
-
- HY-P5681
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
-
- HY-P3397
-
|
|
GHSR
|
Cancer
|
|
JV-1-36 is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
-
- HY-P2786A
-
-
- HY-P3397A
-
|
|
GHSR
|
Cancer
|
|
JV-1-36 acetate is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 acetate inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
-
- HY-P1427A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Guangxitoxin 1E TFA is the TFA salt form of Guangxitoxin 1E (HY-P1427). Guangxitoxin 1E TFA is a peptide toxin and a selective inhibitor for voltage-gated potassium channel KV2.1 and KV2.2 with IC50 of 1-3 nM. Guangxitoxin 1E TFA enhances glucose-stimulated intracellular calcium ion oscillations and increases insulin secretion in a glucose-dependent manner .
|
-
- HY-P4886A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) TFA is a precursor of Pyr peptide. Pyroglutamic acid-modified Aβ (pEAβ) (3-42) is the core of the amyloid plaque in Alzheimer's disease. pEAβ (3-42) accelerates the aggregation of Aβ(1-42), while Aβ(1-42) significantly slows down the primary and secondary nucleation of pEAβ(3-42).
|
-
- HY-P10745
-
|
ZP8396
|
Amylin Receptor
|
Metabolic Disease
|
|
Petrelintide (ZP8396) is an amylin analogue that shows potential to reduce body weight. Petrelintide can be utilized in diabetes research .
|
-
- HY-P5057B
-
|
|
Fluorescent Dye
Bacterial
|
Infection
|
|
5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity .
|
-
- HY-P5057A
-
|
|
Fluorescent Dye
Bacterial
|
Infection
|
|
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy .
|
-
- HY-P1242B
-
|
|
Drug Derivative
|
Inflammation/Immunology
|
|
NEP(1-40), N-terminal uncapped is a NEP(1-40) (HY-P1242) analog without the acetylation modification at the N-terminal. NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide .
|
-
- HY-P1362
-
|
Amyloid β Peptide (42-1)(human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease .
|
-
- HY-P1363
-
|
Amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-P1388
-
|
Amyloid β-peptide (1-42) (rat/mouse)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
-
- HY-P1388A
-
|
Amyloid β-peptide (1-42) (rat/mouse) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
-
- HY-P1242
-
|
|
ROCK
|
Inflammation/Immunology
|
|
NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition .
|
-
- HY-P1378
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
-
- HY-P1378A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
-
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
-
- HY-P0265AS
-
|
Amyloid Beta-Peptide-15N (1-40) (human) TFA; Amyloid β-Peptide-15N (1-40) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid- 15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].
|
-
- HY-P4585
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Gln22)-Amyloid β-Protein (1-42) is a Dutch mutation (E22Q) form of β-Amyloid (1-42) (HY-P1363). (Gln22)-Amyloid β-Protein (1-42) exhibits enhanced fibrillogenic and pathogenic properties .
|
-
- HY-P4391
-
-
- HY-P4640
-
-
- HY-P5285
-
|
|
Parasite
|
Infection
Inflammation/Immunology
Cancer
|
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells .
|
-
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
-
- HY-P1363F1
-
|
Biotin-amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
Biotin-β-Amyloid (1-42), human TFA (Biotin-Amyloid β-Peptide (1-42) (human) TFA) is the botin labeled β-Amyloid (1-42), human TFA (HY-P1363). β-Amyloid (1-42), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-P2699
-
|
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
-
- HY-P5905
-
|
Citrullinated Aβ (1-42); Citrullinated Aβ42
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets .
|
-
- HY-P4867
-
|
|
Amyloid-β
|
Others
|
|
β Amyloid (1-42) (scrambled) is acontrol of β-Amyloid (1-42), human TFA (HY-P1363).
|
-
- HY-P5603
-
|
BNBD-12
|
Bacterial
|
Infection
|
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
-
- HY-P5628
-
|
|
Bacterial
|
Infection
|
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
-
- HY-P5780
-
|
|
Sodium Channel
|
Neurological Disease
|
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
-
- HY-P3684A
-
|
|
CRFR
|
Neurological Disease
|
|
[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat .
|
-
![[DPro5] Corticotropin Releasing Factor, human, rat TFA](//file.medchemexpress.eu/product_pic/hy-p3684a.gif)
- HY-P10093
-
|
|
PI3K
|
Others
|
|
Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system diseases .
|
-
- HY-P10255
-
|
|
Potassium Channel
|
Cancer
|
|
K90-114TAT is an inhibitor for EAG2-Kvβ2 interaction, and exhibits antitumor efficacy against glioblastomas .
|
-
- HY-P10341
-
|
|
GCGR
|
Metabolic Disease
|
|
ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research .
|
-
- HY-P1363A
-
|
Amyloid β-peptide (1-42) (human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human (Amyloid β-peptide (1-42), human) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
-
- HY-P10378
-
|
|
GnRH Receptor
|
Metabolic Disease
|
|
GPR10 agonist 1 (compound 18-S4) is a potent GPR10 agonist with EC50 values of 80, 7.8 nM in the presence (10%) or absence (0%) of FBS, respectively. GPR10 agonist 1 has the potential for the research of chronic obesity .
|
-
- HY-P10487
-
|
|
Amyloid-β
|
Neurological Disease
|
|
APP669-711 is a peptide segment from amino acid 669 to amino acid 711 of amyloid precursor protein (APP). APP669-711 can be used to diagnose the amyloid deposition in the brain, and is a biomarker for Alzheimer's disease (AD) research .
|
-
- HY-P0119
-
|
|
GCGR
MEK
Akt
MMP
JNK
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe −/− Irs 2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation .
|
-
- HY-P1766
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
-
- HY-P1078
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P1078A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
-
- HY-P2538
-
-
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
-
- HY-P1363S
-
|
Amyloid β-peptide-15N (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid- 15N (1-42), human (TFA) is the 15N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].
|
-
- HY-P4211
-
|
|
Bacterial
|
Infection
|
|
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties .
|
-
- HY-P5161A
-
|
|
GCGR
|
Metabolic Disease
|
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
-
- HY-P4861
-
|
|
Amyloid-β
|
Others
|
|
Biotinyl-Ahx-Amyloid β-Protein (1-42) is abiotinylated β-Amyloid (1-42), human (TFA) (HY-P1363).
|
-
- HY-P3014
-
|
|
Potassium Channel
|
Others
|
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
-
- HY-P5624
-
|
|
Bacterial
|
Infection
|
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
-
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
-
- HY-P1363F3
-
|
5-FAM-Amyloid β-peptide (1-42) (human) Tris
|
Amyloid-β
|
Others
|
|
5-FAM-β-Amyloid (1-42), human (5-FAM-Amyloid β-peptide (1-42) (human) TFA is a5-FAM labeled β-Amyloid (1-42), human TFA (HY-P1363).
|
-
- HY-P10271
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
RG7697 is a dual agonist for glucagon-like peptide receptor (GLP Receptor) and glucosedependent insulinotropic polypeptide receptor (GIPR), with EC50 of 5 and 3 pM, respectively. RG7697 exhibits antihyperglycemic property .
|
-
- HY-P2656
-
|
hBD-4
|
Bacterial
|
Infection
|
|
β-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity .
|
-
- HY-P10302
-
|
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-P10302A
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
-
- HY-P1346A
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1346
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
-
- HY-P1074
-
|
|
Calcium Channel
|
Neurological Disease
|
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
-
- HY-P3255
-
-
- HY-P4860
-
|
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
-
- HY-P4884
-
-
- HY-P6013
-
|
|
Calcium Channel
|
Others
|
|
wt hMLN is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
-
- HY-P10230
-
|
|
Bacterial
|
Infection
|
|
Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM .
|
-
- HY-P10591
-
|
Olatorepatidum
|
Insulin Receptor
GLP Receptor
|
Metabolic Disease
|
|
Olatorepatide (Olatorepatidum) is a dual gastric inhibitory polypeptide (GIP) receptor and glucagon like peptide 1 (GLP-1) receptor agonist, with antidiabetic effect .
|
-
- HY-P1411
-
|
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
-
- HY-P1573A
-
-
- HY-P1411A
-
|
PcTx1 TFA; Psalmopoeus cambridgei toxin-1 TFA
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
|
Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease .
|
-
- HY-P1607
-
-
- HY-P3384
-
|
|
Antibiotic
|
Others
Inflammation/Immunology
|
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
-
- HY-P1305A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
-
- HY-P1304A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
-
- HY-P1304
-
-
- HY-P1305
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
-
- HY-P5754B
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 acetate is a therapeutic candidate for axonal regeneration and functional recovery after stroke. TAT-NEP1-40 acetate can protect PC12 cells against oxygen and glucose deprivation (OGD) and promote neurite outgrowth. TAT-NEP1-40 acetate protects the brain against ischemia/reperfusion injury through inhibition of neuronal apoptosis. TAT-NEP1-40 acetate can be efficiently delivered into the rat brains .
|
-
- HY-P5754
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
- HY-P5754A
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
-
- HY-P1080
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
-
- HY-P1080A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
-
- HY-P4976
-
-
- HY-P5954
-
|
|
Calcium Channel
|
Others
|
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
-
- HY-P5063
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
-
- HY-P5064
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide that was first isolated from the porcine hypothalamus. Galanin-Like Peptide (porcine) has a high affinity for the GALR2 receptor (IC50 of 0.24 nM) and a lower affinity for the GALR1 receptor (IC50 of 4.3 nM) .
|
-
- HY-108905
-
|
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
-
- HY-P4815
-
|
|
Endogenous Metabolite
|
Neurological Disease
Metabolic Disease
|
|
Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity .
|
-
- HY-P3103
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
PINT-87aa, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa suppresses glioblastoma cell proliferation in vitro and in vivo .
|
-
- HY-P3103A
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
PINT-87aa TFA, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa TFA directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa TFA suppresses glioblastoma cell proliferation in vitro and in vivo .
|
-
| Cat. No. |
Product Name |
Type |
-
- HY-P1363F3
-
|
5-FAM-Amyloid β-peptide (1-42) (human) Tris
|
Fluorescent Dyes/Probes
|
|
5-FAM-β-Amyloid (1-42), human (5-FAM-Amyloid β-peptide (1-42) (human) TFA is a5-FAM labeled β-Amyloid (1-42), human TFA (HY-P1363).
|
| Cat. No. |
Product Name |
Type |
-
- HY-W002327
-
|
|
Biochemical Assay Reagents
|
|
Fmoc-Asn(Trt)-OH is a biochemical reagent that can be used as a biological material or organic compound for life science related research. Fmoc-Asn(Trt)-OH can be used for synthesis of Fmoc-based solid-phase peptide synthesis .
|
-
- HY-P5282
-
|
|
Drug Delivery
|
|
ApoA-I mimetic peptide (PVLDLFRELLNELLEALKQKLK) has good lecithin:cholesterol acyl transferase (LCAT) activation potency. ApoA-I mimetic peptide can be used for synthesis of peptide/lipid complex .
|
| Cat. No. |
Product Name |
Target |
Research Area |
-
- HY-P4385
-
|
|
PTHR
|
Metabolic Disease
|
|
(Asn10,Leu11,D-Trp12)-pTH-Related Protein (7-34) amide (human, mouse, rat) is a potent PTH-1R antagonist .
|
-
- HY-136626
-
|
Cbz-Ala-Ala-Asn-AMC
|
Fluorescent Dye
|
Cancer
|
|
Z-Ala-Ala-Asn-AMC (Cbz-Ala-Ala-Asn-AMC) is the legumain substrate. Overexpressed legumain in 293 HEK-Leg cells potently cleaved CBZ-Ala-Ala-Asn-AMC .
|
-
- HY-P10485
-
|
|
Peptides
|
Neurological Disease
|
|
Glp-Asn-Pro-AMC is an inhibitor of thyrotropin-releasing hormone degrading enzyme (TRH-DE) with a Ki value of 0.97 μM .
|
-
- HY-P4282
-
|
|
Peptides
|
Others
|
|
Asn-Val is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P2212
-
|
(Asn1,Val5)-Angiotensin II
|
Angiotensin Receptor
|
Inflammation/Immunology
|
|
Angiotensin amide ((Asn1,Val5)-Angiotensin II) is a potent vasoconstrictor. Angiotensin amide is a derivative of angiotensin II. Angiotensin amide can be used as a cardiac activator .
|
-
- HY-P3716
-
|
|
Peptides
|
Others
|
|
H(-Asn-Pro-Asn-Ala)2-OH is an active petide. H(-Asn-Pro-Asn-Ala)2-OH can be used for the research of various biochemical .
|
-
- HY-148389
-
|
Sialylglycoasparaginate
|
Peptides
|
Others
|
|
Disialo-Asn is a N-Glycan and sialate glycopeptide. Disialo-Asn can be used for modify nucleic acids .
|
-
- HY-P4893
-
|
|
Peptides
|
Cardiovascular Disease
|
|
(Gln22,Asn23)-Amyloid β-Protein (1-40) is a peptide. (Gln22,Asn23)-Amyloid β-Protein (1-40) can be used for the research of Cerebral Amyloid Angiopathy Mutations .
|
-
- HY-W009085
-
-
- HY-W008233
-
-
- HY-P3220
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
[D-Asn5]-Oxytocin possesses very low specific oxytocic and vasodepressor activities. By cumulative dose-response studies for oxytocic activity, [D-Asn5]-Oxytocin has similar intrinsic activity to oxytocin .
|
-
- HY-P5331
-
|
|
Peptides
|
Others
|
|
[Asn23]-beta-Amyloid (1-42), iowa mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Iowa mutation, where Asp 23 is replaced with Asn, is associated with severe cerebral amyloid beta-protein angiopathy (CAA). The affected individuals share a missense mutation in APP at position 694. The mutated beta-amyloid peptide aggregates more rapidly and forms toxic fibrils.)
|
-
- HY-P4940
-
|
|
Peptides
|
Others
|
|
Abz-Val-Asn-Leu-Asp-Ala-Glu-EDDnp is a quenched fluorometric substrate .
|
-
- HY-P4639
-
|
|
Peptides
|
Others
|
|
H-Trp-Asn-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4374
-
|
|
Peptides
|
Others
|
|
H-Leu-Asn-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4430
-
|
|
Peptides
|
Others
|
|
H-Met-Asn-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4485
-
|
|
Peptides
|
Others
|
|
H-Pro-Asn-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-P4407
-
|
|
Peptides
|
Metabolic Disease
|
|
(D-Asn28)-Exenatide is an Exenatide (HY-13443) impurity. Exenatide is a long-acting glucagon-like peptide-1 receptor agonist .
|
-
- HY-P5365
-
|
|
Peptides
|
Others
|
|
[Asn23] β-Amyloid (1-40), Iowa mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. The Iowa mutation, where Asp 23 is replaced with Asn, is associated with severe cerebral amyloid beta-protein angiopathy (CAA). The affected individuals share a missense mutation in APP at position 694. The mutated beta-amyloid peptide aggregates more rapidly and forms toxic fibrils.)
|
-
- HY-P3615
-
-
- HY-148031
-
|
|
ADC Linker
|
Others
|
|
MC-Ala-Ala-Asn-PAB-PNP is a peptide, can be used to synthesize specifically activated micromolecular target coupling body .
|
-
- HY-P2397
-
-
- HY-P2401
-
-
- HY-P4019
-
|
|
HIV Protease
|
Others
|
|
Ac-Ser-Gln-Asn-Tyr-Pro-Val-Val-NH2 is a substrato peptídico of HIV-1 protease. Ac-Ser-Gln-Asn-Tyr-Pro-Val-Val-NH2 acts as the variable substrate in a peptidolytic assay to quantify the inhibition of the protease .
|
-
- HY-P5008
-
|
|
Peptides
|
Others
|
|
Cbz-Asn-Gly-OH is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
-
- HY-136733
-
|
Ac-Asp-Asn-Leu-Asp-CHO
|
Caspase
|
Infection
Neurological Disease
|
|
Ac-DNLD-CHO (Ac-Asp-Asn-Leu-Asp-CHO) is a Caspase-3/7 inhibitor (IC50: 9.89, 245 nM respectively; Ki app: 0.68, 55.7 nM respectively). Ac-DNLD-CHO can be used for research of caspase-mediated apoptosis diseases, such as neurodegenerative disorders and viral infection diseases .
|
-
- HY-P5373
-
|
|
Peptides
|
Others
|
|
Ser-parafluoroPhe-Aad-Leu-Arg-Asn-Pro-NH2 is a biological active peptide. (Structure-activity studies of thrombin receptor-tethered ligand SFLLRNP have revealed
the importance of the Phe-2-phenyl group in receptor recognition and the replacement of the
Phe-2 by para-fluorophenylalanine [(p-F)Phe] was found to enhance its activity)
|
-
- HY-114174
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Asn-Lys-NH2 is a selective asparagine endopeptidase (AEP) inhibitor peptide and suppresses amyloid precursor protein (APP) cleavage. AEP, a pH-controlled cysteine proteinase, is activated during ageing and mediates APP proteolytic processing .
|
-
- HY-W091365
-
|
N-Boc-N'-xanthyl-L-asparagine
|
Amino Acid Derivatives
|
Others
|
|
Boc-Asn(Xan)-OH (N-Boc-N'-xanthyl-L-asparagine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize locust fat growth hormone .
|
-
- HY-P1962
-
|
[Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)
|
Beta-secretase
|
Neurological Disease
|
|
β-Secretase inhibitor ([Asn670, Sta671, Val672]-Amyloid β Peptide (662-675)) is a β-secretase and BACE1 inhibitor (IC50: 25 nM for β-secretase) .
|
-
- HY-P3760
-
|
|
Peptides
|
Others
|
|
H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH is an peptide. H-Pro-Phe-Thr-Arg-Asn-Tyr-Tyr-Val-Arg-Ala-Val-Leu-His-Leu-OH can be used for the research of various biochemical studies .
|
-
- HY-P1810
-
|
|
Peptides
|
Neurological Disease
|
|
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-Agm is a is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.25 and 0.05 nM for hV2R and rV2R, respectively .
|
-
- HY-P5415
-
|
|
HIV
|
Others
|
|
DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS is a biological active peptide. (DABCYL-GABA-Ser-Gln-Asn-Tyr-Pro-Ile-Val-Gln-EDANS is also called HIV protease substrate I in some literature. It is widely used for the continuous assay for HIV protease activity. The 11-kD protease (PR) encoded by the human immunodeficiency virus 1 (HIV-1) is essential for the correct processing of viral polyproteins and the maturation of infectious virus, and is therefore a target for the design of selective acquired immunodeficiency syndrome (AIDS) therapeutics. The FRET-based fluorogenic substrate is derived from a natural processing site for HIV-1 PR. Incubation of recombinant HIV-1 PR with the fluorogenic substrate resulted in specific cleavage at the Tyr-Pro bond and a time-dependent increase in fluorescence intensity that is linearly related to the extent of substrate hydrolysis. The fluorescence quantum yields of the HIV-1 PR substrate in the FRET assay increased by 40.0- and 34.4-fold, respectively, per mole of substrate cleaved. Because of its simplicity and precision in the determination of reaction rates required for kinetic analysis, this substrate offers many advantages over the commonly used HPLC or electrophoresis-based assays for peptide substrate hydrolysis by retroviral PRs. Abs/Em = 340nm/490nm.)
|
-
- HY-P1809
-
|
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2
|
Peptides
|
Metabolic Disease
|
|
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively .
|
-
- HY-P1809A
-
|
c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2 acetate
|
Peptides
|
Metabolic Disease
|
|
Velmupressin (c(Bua-Cpa-Thi-Val-Asn-Cys)-Pro-d-Arg-NEt2) acetate is a potent, selective and short-acting peptidic V2 receptor (V2R) agonist with EC50s of 0.07 and 0.02 nM for hV2R and rV2R, respectively .
|
-
- HY-P1043A
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide Trifluoroacetatecontaining the Asn-Gly-Arg (NGR) motif. NGR peptide Trifluoroacetate binds to APN/CD13. NGR peptide Trifluoroacetate is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-P1043
-
|
|
Aminopeptidase
|
Cancer
|
|
NGR peptide containing the Asn-Gly-Arg (NGR) motif. NGR peptide binds to APN/CD13. NGR peptide is directly conjugated to imaging agents that can be used for tumor imaging .
|
-
- HY-W010719
-
-
- HY-P1610
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Asudemotide (S-588410) is a peptide of human DEP domain-containing protein 1A. Asudemotide is an immunostimulant. Asudemotide has a sequence of H-Glu-Tyr-Tyr-Glu-Leu-Phe-Val-Asn-Ile-OH. Asudemotide induces a tumor immune response in esophageal cancer. .
|
-
- HY-P4919
-
|
|
Beta-secretase
|
Others
|
|
Mca-SEVNLDAEFK(Dnp) is a Beta-secretase 1 (BACE-1) peptide FRET substrate, containing the 'Swedish' Lys-Met/Asn-Leu mutation of the amyloid precursor protein (APP) β-secretase cleavage site. Cleavage at -Leu-Asp- of Mca-SEVNLDAEFK(Dnp) liberates the highly fluorescent 7-methoxycoumarin (Mca) fragment from the proximity quenching effect of the 2,4-dinitrophenyl (Dnp) internal quencher resulting in a large and easily detectable increase in fluorescence intensity.
|
-
- HY-P3882
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Fmoc-Ala-Glu-Gln-Lys-NH2 (AEQK) is a tetrapeptide. Fmoc-Ala-Glu-Gln-Lys-NH2 is the inactive control for Fmoc-Ala-Glu-Asn-Lys-NH2 (AENK) peptide inhibitor. AENK blocks proteolysis of UNC5C protein .
|
-
- HY-W088100
-
|
N-Boc-N'-trityl-D-asparagine; Boc-D-Asn(Trt)-OH
|
Amino Acid Derivatives
|
Cancer
|
|
Boc-N-gamma-trityl-D-asparagin (N-Boc-N'-trityl-D-asparagine) is an amino acid derivative with a Boc protecting group, which can be used to synthesize metastasis-inhibiting or tumor growth-inhibiting metastasis-inhibiting MS derivatives .
|
-
- HY-P3465
-
|
Myrcludex B
|
HBV
|
Infection
|
|
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research .
|
-
- HY-P5119
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 190-208 (HY-P5118), as Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P5119A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 168-189 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 168-189 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 168-189 is the negtive control of Tat-peptide 168-189 TFA (HY-P5118A), as Tat-peptide 168-189 TFA increases axon growth and increases the number of neurites per neuron .
|
-
- HY-P5174
-
|
|
Sodium Channel
|
Neurological Disease
|
|
MitTx is a complex formed by MitTx-α and MitTx-β. MitTx is an ASIC1 channel activator with EC50 values of 9.4 and 23 nM for ASIC1a and ASIC1b isoforms, respectively. MitTx is highly selective for ASIC1 isoforms at neutral pH. Under acidic conditions, MitTx greatly enhances proton-evoked ASIC2a channel activation .
|
-
- HY-P4066
-
|
|
Peptides
|
Cancer
|
|
Emfilermin is a recombinant human leukaemia inhibitory factor (LIF) that can be used in chemotherapy-induced peripheral neuropathy studies .
|
-
- HY-P4327
-
|
|
Bacterial
|
Infection
|
|
Hispidalin is a novel antimicrobial peptide with broad and efficient antibacterial activity against various bacterial and fungal pathogens, and can be used as an antibacterial agent and food preservative .
|
-
- HY-P5118
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
-
- HY-P5118A
-
|
|
Peptides
|
Neurological Disease
|
|
Tat-peptide 190-208 TFA is a cell-permeable and Tat-labeled fusion peptide, corresponding to residues 190-208 of rat G3BP1. Tat sequence from HIV, is placed at the least conserved end of the sequence, for cell permeability. Tat-peptide 190-208 TFA increases axon growth and increases the number of neurites per neuron. Tat-peptide 190-208 TFA likely exhibits an axon intrinsic mechanism. Tat-peptide 190-208 TFA can be used for ischemic protection during endovascular repair for intracranial aneurysms .
|
- HY-P0058A
-
- HY-P0058
-
- HY-P0058B
-
- HY-P1464
-
|
Amylin (rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, rat is a potent and high affinity ligand of Amylin receptor AMY1 and AMY3 receptors and variably of AMY2 receptors; binding studies are generally used for the latter receptor.
|
- HY-P1070
-
|
DAP amide, human
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1871
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P1070A
-
|
DAP amide, human TFA
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin, amide, human TFA, a 37-amino acid polypeptide, is a pancreatic hormone cosecreted with insulin that exerts unique roles in metabolism and glucose homeostasis. Amylin, amide, human TFA inhibits glucagon secretion, delays gastric emptying, and acts as a satiety agent .
|
- HY-P1871A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (IAPP), feline TFA is a 37-amino acid polypeptide from feline. Amylin (IAPP), feline TFA is one of the major secretory products of β-cells of the pancreatic islets. Amylin (IAPP), feline TFA is a regulatory peptide, which inhibits insulin and glucagon secretion .
|
- HY-P4928
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P4863
-
|
|
Peptides
|
Others
|
|
Biotinyl-Amylin (human) is abiotinylated Amylin, amide, human (HY-P1070).
|
- HY-P4928A
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Biotinyl-Amylin (mouse, rat) TFA is a biotinylated Amylin (mouse, rat). Amylin (mouse, rat) is a 37-aminoacid pancreatic protein that exerts control over several metabolic events such as glycemia and lacticemia .
|
- HY-P4732
-
|
|
Peptides
|
Others
|
|
5-FAM-Amylin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4911
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) can be used in cardiovascular disease research .
|
- HY-P5783
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj2a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 32 nM. δ-Buthitoxin-Hj2a can be used for the Dravet syndrome (DS) research .
|
- HY-P4911A
-
|
|
CXCR
|
Cardiovascular Disease
|
|
SDF-1α (human) TFA is a mononuclear cells chemoattractant that can bind to CXCR4. SDF-1α plays a central role in stem cell homing, retention, survival, proliferation, cardiomyocyte repair, angiogenesis and ventricular remodelling following myocardial infarction. SDF-1α (human) TFA can be used in cardiovascular disease research .
|
- HY-P2145
-
|
EDF
|
Bacterial
|
Infection
|
|
Extracellular death factor (EDF) is the only single signaling molecule involved in Escherichia coli quorum sensing, and can initiate MAZEF-mediated cell death. Extracellular death factor significantly amplifies the endoribonucleolytic activities of both MazF and ChpBK .
|
- HY-P1473
-
|
Amylin (8-37) (mouse, rat)
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (8-37), rat is a truncated analog of native Amylin that selectively inhibits insulin-related glucose uptake and glycogen deposition in muscle tissue. Amylin (8-37), rat is a weak amylin receptor (AMY) antagonist.
|
- HY-P2501
-
|
|
Amylin Receptor
|
Metabolic Disease
|
|
Amylin (8-37), human is a fragment of human Amylin. Amylin (8-37), human has direct vasodilator effects in the isolated mesenteric resistance artery of the rat. Human Amylin is a small hormone secreted by pancreatic β-cells that forms aggregates under insulin deficiency metabolic conditions, and it constitutes a pathological hallmark of type II diabetes mellitus .
|
- HY-P4785
-
- HY-P1858
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III, mouse is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
- HY-P1858A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III, mouse TFA is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III preferentially binds and activates CRF-R2 . Urocortin III (Ucn3) is a known component of the behavioral stress response system. Urocortin III and CRF-R2 in the medial amygdala regulate complex social dynamics .
|
- HY-P3019
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Urocortin III (human) is a corticotropin-releasing factor (CRF)-related peptide. Urocortin III (human) preferentially binds and activates CRF-R2 and has a discrete central nervous system and peripheral distribution. Urocortin III (human) selectively binds to type 2 CRF receptors with Ki values of 13.5, 21.7, and >100 nM for mCRF2β, rCRF2α, and hCRF1, respectively. Urocortin III (human) mediates somatostatin-dependent negative feedback control of Insulin (human) (HY-P0035) secretion .
|
- HY-P5816
-
|
|
Sodium Channel
|
Neurological Disease
|
|
BmK-M1 is a scorpion toxin, and is composed of 64 amino acids cross-linked by four disulfide bridges. BmK-M1 inhibits Na + channel and can be considered both as a cardiotoxin and a neurotoxin .
|
- HY-P5394
-
|
|
Peptides
|
Others
|
|
Dby HY Peptide (608-622), mouse is a biological active peptide. (Dby HY Peptide, NAGFNSNRANSSRSS, is a HYAb epitope belonging to a well-conserved family of genes coding for known or putative RNA helicases and containing a core sequence with a DEAD (Asp-Glu-Ala-Asp) box peptide motif, hence the name Dby (Dead box RNA helicase Y). The single Phenylalanine in the sequence serves as the anchor point while FNSNRANSS most likely is the “core” sequence of this HYAb epitope.)
|
- HY-P3462
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide is an investigational novel long-acting acylated amylin analogue, acts as nonselective amylin receptors (AMYR) and calcitonin G protein-coupled receptor (CTR) agonist. Cagrilintide induces significant weight loss and reduces food intake. Cagrilintide has the potential for the research of obesity .
|
- HY-P3462A
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Cagrilintide acetate is a non-selective AMYR/CTR agonist and long-acting acylated amylase analogue. Cagrilintide acetate causes a reduction in food intake and significant weight loss in a dose-dependent manner. Cagrilintide acetate can be used in obesity studies .
|
- HY-P5142
-
|
ω-ACTX-Hv1; ω-Atracotoxin-HV1
|
Calcium Channel
|
Neurological Disease
|
|
ω-Hexatoxin-Hv1a is a neurotoxin that can be isolated from the venom spider (Hadronyche versuta).ω-Hexatoxin-Hv1a blocks voltage-gated calcium channels .
|
- HY-P10801
-
|
C46 peptide
|
HIV
|
Infection
|
|
mC46 (C46) peptide is a membrane-associated fusion peptide inhibitor. mC46 peptide potently inhibits HIV-1 replication and entry. mC46 also inhibits CCR5-tropic, CXCR4-tropic, and dual-tropic HIVs, SIV, and SHIV .
|
- HY-P3012
-
|
|
Cathepsin
|
Inflammation/Immunology
|
|
Cathepsin G acts as a potent agonist of human platelet activation leading to their aggregation., and can be used for screening of relevant inhibitors .
|
- HY-P10327
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
PP18 is a novel OXM-based dual GLP-1 and glucagon receptor agonist with EC50 values of 0.487 nM target hGLP-1R and 0.188 nM target hGcgR .
|
- HY-P1441
-
|
|
Sodium Channel
|
Others
|
|
Mambalgin-1 is a toxin isolated from black mamba venom. Mambalgin-1 is a disulfide-rich polypeptide consisting of 57 amino acids and belongs to the family of three-finger toxins. Mambalgin-1 can bind to and stabilize ASICs (acid-sensing ion channels) in a physiologically relevant closed-channel conformation .
|
- HY-P4933
-
|
|
Tau Protein
|
Others
|
|
Tau Peptide (255-314) (Repeat 2 Domain) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5863
-
|
Mamb-2
|
Sodium Channel
|
Neurological Disease
|
|
Mambalgin-2 (Mamb-2) is an acid-sensitive ion channels (ASICs) inhibitor and a venom peptide. Mambalgin-2 can be obtained from the venom of the African black mamba. Mambalgin-2 can be used in the study of pain and neurological diseases .
|
- HY-P10323
-
|
Tumstatin (74-98), human
|
Integrin
FAK
mTOR
Apoptosis
|
Cancer
|
|
T7 peptide is an endothelial cell-specific inhibitor. T7 peptide interacts with αVβ3 integrin to inhibit the FAK, PI3-kinase, PKB/Akt, and mTOR signaling pathways in endothelial cells, ultimately suppressing protein synthesis and inducing apoptosis .
|
- HY-P4811
-
|
|
Peptides
|
Metabolic Disease
|
|
Prepro-Atrial Natriuretic Factor (26-55) (human) is a polypeptide that increases renal cortical and medullary cyclic GMP levels. Prepro-Atrial Natriuretic Factor (26-55) (human) increases renal guanylate cyclase activity .
|
- HY-P5899
-
- HY-P5869
-
|
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Kurtoxin is a selective Cav3 (T-type) voltage-gated Ca 2+ channel gating inhibitor with a Kd of 15 nM for Cav3.1 (α1G T-type) Ca 2+ channel. Kurtoxin can interact with high affinity with native neuronal high-threshold L-type, N-type, and P-type Ca 2+ channels in central and peripheral neurons. Kurtoxin also shows cross-reactivity with voltage-gated Na + channel .
|
- HY-P10299
-
|
|
Peptides
|
Others
|
|
Calcitonin, porcine inhibits 1,25 (OH)2D3-stimulated porcine osteoclast differentiation. Calcitonin is a polypeptide hormone that can lower serum calcium by decreasing calcium reabsorption in the kidney and inhibiting osteoclastic bone resorption. Calcitonin, porcine can be used for research of hypercalcemia .
|
- HY-P5497
-
|
|
HIV
|
Others
|
|
C34 peptide is a biological active peptide. (This C34 peptide, also known as HR2, belongs to the helical region of gp41 of HIV, C-terminal heptad repeat 2 (HR2) defined as C helix or C peptide. It is known that HIV-1 enters cells by membrane fusion, C34 gp41 peptide is a potent inhibitors of HIV-1 fusion.)
|
- HY-P1144
-
|
Glucagon-37 (bovine, porcine)
|
GCGR
|
Metabolic Disease
|
|
Oxyntomodulin (bovine, porcine), a 37-amino acid peptide hormone, is a glucagon-like peptide 1 (GLP-1) receptor agonist .
|
- HY-P4796
-
|
Proglucagon (33-69)
|
Peptides
|
Metabolic Disease
|
|
Oxyntomodulin (human, mouse, rat) (Proglucagon (33-69)) is a product of the glucagon precursor. Oxyntomodulin (human, mouse, rat) contains the entire glucagon sequence plus a C-terminal octapeptide, comprising in total 37 amino acids.
|
- HY-P5846
-
|
MT3
|
mAChR
Adrenergic Receptor
|
Neurological Disease
|
|
Muscarinic toxin 3 (MT3) is a potent and non-competitive mAChR and adrenoceptors antagonist with pIC50s of 6.71, 8.79, 8.86, 7.57, 8.13, 8.49, <6.5, 7.29 against M1, M4, α1A, α1B, α1D,α2A,α2B and α2C receptors, respectively. Muscarinic toxin 3 displays prominent adrenoceptor activity .
|
- HY-P10385A
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-3 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-3 (HY-P10385). SPSB2-iNOS inhibitory cyclic peptide-3 TFA is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 7 nM .
|
- HY-P10385
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-3 (Compound CP3) is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 7 nM .
|
- HY-P4845
-
|
|
Peptides
|
Others
|
|
pTH (7-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1443
-
|
|
Sodium Channel
|
Cancer
|
|
OD1 is a scorpion α-toxin that can be isolated from the venom of the Iranian yellow scorpion (Odonthobuthus doriae. OD1 is a modulator of mammalian Nav1.7 (EC50: 4.5 nM) .
|
- HY-P5340
-
|
|
Peptides
|
Others
|
|
Amyloid-Forming peptide GNNQQNY is a biological active peptide. (This is a heptapeptide from the N-terminal prion-determining domain of the yeast protein Sup35 that forms amyloid fibrils. The availability of its detailed atomic oligomeric structure makes it a good model for studying the early stage of aggregation. The GNNQQNY dimer forms three stable sheet structures. in-register parallel, off-register parallel, and anti-parallel. The in-register parallel dimer, which is close to the amyloid beta-sheet structure, has few interpeptide hydrogen bonds, making hydrophobic interactions more important and increasing the conformational entropy compared to the anti-parallel sheet.)
|
- HY-P10384
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-2 (Compound CP2) is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 21 nM. SPSB2-iNOS inhibitory cyclic peptide-2 is reduction-resistant and oxidatively stable .
|
- HY-P10384A
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-2 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-2 (HY-P10384). SPSB2-iNOS inhibitory cyclic peptide-2 TFA is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 21 nM. SPSB2-iNOS inhibitory cyclic peptide-2 TFA is reduction-resistant and oxidatively stable .
|
- HY-P1542
-
|
Catostomus urotensin I
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
|
Urotensin I (Catostomus urotensin I), a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
- HY-P1542B
-
|
Catostomus urotensin I TFA
|
CRFR
|
Cardiovascular Disease
Endocrinology
|
|
Urotensin I (Catostomus urotensin I) TFA, a CRF-like neuropeptide, acts as an agonist of CRF receptor with pEC50s of 11.46, 9.36 and 9.85 for human CRF1, human CRF2 and rat CRF2α receptors in CHO cells, and Kis of 0.4, 1.8, and 5.7 nM for hCRF1, rCRF2α and mCRF2β receptors, respectively .
|
- HY-P5153
-
|
μ-TRTX-Tp1a
|
Sodium Channel
|
Neurological Disease
|
|
ProTx-III is a selective and potent inhibitor of voltage-gated sodium channel Nav1.7, with an IC50 of 2.1 nM. ProTx-III is a spider venom peptide isolated from the venom of the Peruvian green velvet tarantella. ProTx-III has a typical inhibitor cystine knot motif (ICK). ProTx-III is able to reverse the pain response. ProTx-III can be used to study diseases such as chronic pain, epilepsy, and arrhythmia .
|
- HY-P5901
-
- HY-P2710
-
|
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Noxiustoxin is a toxin from the venom of the Mexican scorpion Centruroides noxius which block voltage-dependent potassium channel (Kv1.3, IC50 = 360 nM), and calcium-activated potassium channel. Noxiustoxin plays an important role in neuroinflammatory disease .
|
- HY-P10352
-
|
|
Bacterial
|
Infection
|
|
Pediocin PA-1 is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogens such as Listeria monocytogenes and Gram-positive bacteria. Pediocin PA-1 can be used as a food biopreservative .
|
- HY-P10352A
-
|
|
Bacterial
|
Infection
|
|
Pediocin PA-1 TFA is a broad-spectrum lactic acid bacterial bacteriocin that inhibits the activity of foodborne pathogens such as Listeria monocytogenes and Gram-positive bacteria. Pediocin PA-1 TFA can be used as a food biopreservative .
|
- HY-P2322
-
- HY-P5584
-
- HY-P4097
-
|
|
Peptides
|
Others
|
|
293P-1 is a peptide with tissue-specific homing properties. 293P-1 is specific for hepatocytes with sequences of SNNNVRPIHIWP .
|
- HY-P2540
-
|
|
Peptides
|
Metabolic Disease
|
|
Leptin (93-105), human, is the amino acids 93 to 105 fragment of human leptin. Leptin is a 167-residue peptide hormone mainly produced by adipocytes and acts in the central nervous system to primarily coordinate the metabolic adaptations to fasting .
|
- HY-P5140
-
|
|
Calcium Channel
|
Metabolic Disease
|
|
ω-Tbo-IT1 is a peptide toxin that can be isolated from the venom of Tibellus oblongus.ω-Tbo-IT1 is an inhibitor of insect calcium channel .
|
- HY-P3641
-
|
|
GnRH Receptor
|
Neurological Disease
Metabolic Disease
|
|
Kisspeptin 13 inhibits glucose-induced insulin secretion with an IC50 of 1.2 nM. Kisspeptin 13 activates the hypothalamic-pituitary-adrenal (HPA) axis, causes hyperthermia, motor behavior and anxiety in rats. Kisspeptin 13 interacts with α2-adrenergic and 5-HT2 serotonin receptors, exhibits antidepressant efficacy. Kisspeptin 13 is an activator for GPR54 and GnRH receptor, which enhances memory and can be used in Alzheimer's disease research .
|
- HY-P10383
-
|
|
NO Synthase
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P10383A
-
|
|
Peptides
|
Infection
|
|
SPSB2-iNOS inhibitory cyclic peptide-1 TFA is the TFA salt form of SPSB2-iNOS inhibitory cyclic peptide-1(HY-P10383). SPSB2-iNOS inhibitory cyclic peptide-1 is an inhibitor for the interaction of SPRY domain and SOCS-box protein 2 (SPSB2) and iNOS, through binding SPSB2 on iNOS site with KD of 4.4 nM. SPSB2-iNOS inhibitory cyclic peptide-1 is resistant to the proteases pepsin, trypsin and α-chymotrypsin. SPSB2-iNOS inhibitory cyclic peptide-1 is stable in human plasma and in oxidative environment .
|
- HY-P3641A
-
|
|
GnRH Receptor
|
Neurological Disease
Metabolic Disease
|
|
Kisspeptin 13 TFA is the TFA salt form of Kisspeptin 13 (HY-P3641). Kisspeptin-13 TFA inhibits glucose-induced insulin secretion with an IC50 of 1.2 nM. Kisspeptin 13 TFA activates the hypothalamic-pituitary-adrenal (HPA) axis, causes hyperthermia, motor behavior and anxiety in rats. Kisspeptin 13 TFA interacts with α2-adrenergic and 5-HT2 serotonin receptors, exhibits antidepressant efficacy. Kisspeptin 13 TFA is an activator for GPR54 and GnRH receptor, which enhances memory and can be used in Alzheimer's disease research .
|
- HY-P10457
-
|
15-PGDH (92-105)
|
15-PGDH
|
Others
|
|
5-Hydroxy prostaglandin dehydrogenase blocking peptide (15-PGDH (92-105)) is a blocking peptide that corresponds to the amino acids (AGVNNEKNWEKTLQ) located at positions 92-105 of the 15-hydroxy prostaglandin dehydrogenase (15-PGDH) sequence. 5-Hydroxy prostaglandin dehydrogenase blocking peptide can block the formation of protein-antibody complexes during immunohistochemical analysis of 15-PGDH .
|
- HY-P10489
-
|
|
Kisspeptin Receptor
|
Others
Cancer
|
|
Kisspeptin-14 human is a peptide hormone encoded by the KiSS-1 gene. Kisspeptin-14 human, along with several other similar peptide hormones, is produced from a common precursor protein by cleavage by different proteases. Kisspeptin-14 human has the same receptor binding efficiency and potency as full-length kisspeptin. Kisspeptin-14 human binds to its receptor GPR54 and is able to activate this G protein-coupled receptor and activate multiple intracellular signaling pathways. Kisspeptin-14 human can be used to study reproductive development and tumor metastasis .
|
- HY-P10229
-
|
|
Peptides
|
Others
|
|
RALF1 peptide is endogenous signals that inhibits growth of plants through apoplast alkalinization and induction of auxin biosynthesis .
|
- HY-P10798
-
- HY-P5095
-
|
|
Peptides
|
Others
|
|
FGF basic (93-110) (human, bovine) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P10586
-
|
MALP-2
|
Toll-like Receptor (TLR)
NO Synthase
|
Cardiovascular Disease
|
|
Macrophage-activating lipopeptide 2 (MALP-2) is an agonist of Toll like receptors TLR-2/TLR-6. Macrophage-activating lipopeptide-2 can enhance endothelial nitric oxide synthase (eNOS) phosphorylation and endothelial cell release of NO, thereby improving vasodilation. Macrophage-activating lipopeptide-2 can enhance endothelial adhesion of white blood cells and improve perfusion recovery and collateral growth in the hind limbs of hypercholesterolemic Apoe deficient mice undergoing experimental femoral artery ligation (FAL) .
|
- HY-P10586A
-
|
MALP-2 TFA
|
Toll-like Receptor (TLR)
NO Synthase
|
Cardiovascular Disease
Metabolic Disease
|
|
Macrophage-activating lipopeptide 2 TFA is an agonist of Toll like receptors TLR-2/TLR-6. Macrophage-activating lipopeptide-2 enhances endothelial nitric oxide synthase (eNOS) phosphorylation and endothelial cell release of NO, thereby improving vasodilation. Macrophage-activating lipopeptide-2 enhances endothelial adhesion of white blood cells and improve perfusion recovery and collateral growth in the hind limbs of hypercholesterolemic Apoe deficient mice undergoing experimental femoral artery ligation (FAL) .
|
- HY-P3055
-
|
DTX-I
|
Potassium Channel
|
Neurological Disease
Cancer
|
|
Dendrotoxin-I (DTX-I) is a potent K + channels blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6, respectively. Dendrotoxin-I, a neurotoxin, has the potential for cancer research .
|
- HY-P5797
-
- HY-P2707
-
|
α-DTX
|
Sodium Channel
Potassium Channel
|
Others
|
|
α-Dendrotoxin (α-DTX) is a small molecule peptide neurotoxin isolated from the venom of the African green mamba snake (Dendroaspis angusticeps). α-Dendrotoxin is also a KV1.1, KV1.2, KV1.6 and ASIC channel blocker. α-Dendrotoxin blocks potassium channels, lowers the threshold of neuronal action potentials, and increases the frequency of action potentials, thereby enhancing neuronal excitability. α-Dendrotoxin can be used in neurotoxicology research .
|
- HY-P3055A
-
|
DTX-I TFA
|
Potassium Channel
|
Cancer
|
|
Dendrotoxin-I (DTX-I) TFA is a potent K + channel blocker with IC50s of 0.13-50 nM for voltage-gated potassium channel subunits KV1.1, KV1.2 and KV1.6. Dendrotoxin-I TFA, a neurotoxin, has the potential for cancer research .
|
- HY-P1023
-
|
|
GCGR
|
Metabolic Disease
|
|
VIP(6-28)(human, rat, porcine, bovine) is an effective antagonist of the actions of exogenous vasoactive intestinal peptide (VIP) on cAMP.
|
- HY-P4816
-
|
|
Bacterial
Fungal
|
Infection
Inflammation/Immunology
|
|
Pseudin-2, an AMP thast could be isolated from the skin of the South American paradoxical frog Pseudis paradoxa, exert a potent growth inhibitory effect against Gram-negative bacteria .
|
- HY-P10320
-
|
Tumstatin (69-88), human
|
PI3K
Akt
|
Cardiovascular Disease
|
|
T3 Peptide is an active fragment of tumstatin. T3 Peptide binds integrin αvβ3/αvβ5, activates the PI3K/Akt/p70S6K signaling pathway, and thus stimulates the proliferation and migration of rat cardiac fibroblasts .
|
- HY-P5851
-
|
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
AaHI is a neurotoxin that can be obtained from the venom of the North African scorpion Androctonus australis hector. AaHI can be used as a tool for the development of active substances with toxin-neutralizing capabilities .
|
- HY-P5176
-
|
LtTx-1a
|
Peptides
|
Neurological Disease
|
|
Latartoxin-1a (LtTx-1a) is a peptide toxin can be isolated from L. tarabaevi. Latartoxin-1a is paralytic and lethal to insects and has membrane-bound activity .
|
- HY-P5172
-
|
|
Sodium Channel
|
Neurological Disease
|
|
MitTx-alpha is a subunit of MitTx. MitTx is a potent, persistent, and selective agonist for acid-sensing ion channels (ASICs). MitTx is highly selective for the ASIC1 subtype at neutral pH; under more acidic conditions (pH<6.5), MitTx massively potentiates (>100-fold) proton-evoked activation of ASIC2a channels .
|
- HY-P5398
-
|
|
Peptides
|
Others
|
|
HR2-18 is a biological active peptide. (inhibition of SARS-CoV penetration into cells.)
|
- HY-P0285
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells.
|
- HY-P0285A
-
|
|
RABV
|
Infection
|
|
Rabies Virus Glycoprotein (TFA) is a 29-amino-acid cell penetrating peptide derived from a rabies virus glycoprotein that can cross the blood-brain barrier (BBB) and enter brain cells .
|
- HY-P4731
-
|
|
Peptides
|
Others
|
|
Kisspeptin-54 (27-54) (human) is a polypeptide that can be used for compound synthesis and pharmaceutical research .
|
- HY-P5623
-
|
RVG29; RDP; Rabies Virus Glycoprotein-29
|
Bacterial
|
Infection
|
|
RVG (RVG29) is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
- HY-P5005
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
VIPhyb (compound VIPhyb) is a vasoactive intestinal polypeptide (VIP) receptor antagonist that can be used in the study of cancers such as non-small cell lung cancer (NSCLC) .
|
- HY-P5623B
-
|
RVG29 TFA; RDP TFA; Rabies Virus Glycoprotein-29 TFA
|
Bacterial
|
Infection
|
|
RVG TFA is a peptide derived from Rabies Virus Glycoprotein that binds to the α-7 subunit of nicotinic acetylcholine receptors (AchR) of neuronal cells. RVG enhances delivery of Mycobacterium tuberculosis antigens to antigen-presenting cells .
|
- HY-158992S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
SP-(Val- 13C5, 15)-EKNQ-(Leu- 13C6, 15)-TIDFINIVKDPVPHNEYKT TFA is a 13C- and 15N-labeled peptide containing 13C5, 15N-labeled valine (Val) and 13C6, 15N-labeled leucine (Leu).
|
- HY-P4191
-
|
MSPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSN
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) is the antagonist for CCR1 and CCR5. Met-RANTES (human) inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P5144
-
- HY-P5857
-
|
Micrurotoxin 2
|
GABA Receptor
|
Neurological Disease
|
|
MmTx2 toxin is a GABAA receptor modulator that enhances GABAA receptor sensitivity to agonists. MmTx2 toxin can be obtained from venom of coral snake. MmTx2 toxin can be used in the study of neurological diseases such as epilepsy, schizophrenia and chronic pain .
|
- HY-P5860
-
|
Micrurotoxin 1
|
GABA Receptor
|
Neurological Disease
|
|
MmTx1 toxin (Micrurotoxin 1) is an allosteric GABAA receptor modulator that increases GABAA receptor susceptibility to agonist .
|
- HY-P5175
-
|
|
mAChR
|
Neurological Disease
|
|
Muscarinic toxin 7 is a peptide toxin with selective and noncompetitive antagonism at the muscarinic M1 receptor .
|
- HY-P10572
-
- HY-P4191A
-
|
|
CCR
|
Inflammation/Immunology
|
|
Met-RANTES (human) acetate is the acetate form of Met-RANTES (human) (HY-P4191). Met-RANTES (human) acetate is the antagonist for CCR1 and CCR5. Met-RANTES (human) acetate inhibits chemokines human MIP-1α and MIP-1β with IC50 of 5 and 2 nM. Met-RANTES (human) acetate reduces bone destruction and ameliorates rats adjuvant-induced arthritis (AIA) .
|
- HY-P1014
-
- HY-P1127
-
- HY-P1159
-
|
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
[D-p-Cl-Phe6,Leu17]-VIP is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP has no activity on glucagon, secretin or GRF receptors .
|
- HY-P1159A
-
|
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
[D-p-Cl-Phe6,Leu17]-VIP TFA is a competitive and selective antagonist of vasoactive intestinal peptide (VIP) receptor, with the IC50 of 125.8 nM. [D-p-Cl-Phe6,Leu17]-VIP TFA has no activity on glucagon, secretin or GRF receptors .
|
- HY-P5623A1
-
|
RVG29-Cys acetate; RDP-Cys acetate; Rabies Virus Glycoprotein-29-Cys acetate
|
RABV
|
Others
|
|
RVG-Cys (RVG29-Cys;RDP-Cy) acetate is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
- HY-P5623A
-
|
RVG29-Cys; RDP-Cys; Rabies Virus Glycoprotein-29-Cys
|
RABV
|
Others
|
|
RVG-Cys (RVG29-Cys) is based on rabies virus glycoprotein (RVG29) peptide and connected to Cys to facilitate subsequent coupling .
|
- HY-P5912
-
|
|
iGluR
|
Neurological Disease
|
|
GluN1 (356-385) is an antigenic peptide against
N-methyl-D-aspartate receptor (NMDAR) encephalitis. GluN1 (356-385) has the
effect of reducing the density of surface NMDAR clusters in hippocampal
neurons. GluN1 (356-385) can be used to study the pathogenesis of anti-NMDAR
encephalitis .
|
- HY-P2516
-
|
|
Tau Protein
|
Neurological Disease
|
|
Tau Peptide (275-305) (Repeat 2 domain) is the Alzheimer's tau fragment R2, corresponding to the second repeat unit of the microtubule-binding domain, which is believed to be pivotal to the biochemical properties of full tau protein .
|
- HY-P3899
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
[Nle8] Somatostatin (1-28) is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) increases the amylase release.[Nle8] Somatostatin (1-28) increases the cyclic AMP in pancreatic acini .
|
- HY-P3954
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
Somatostatin-28 (sheep, human rat mouse) is a biologically active polypeptide, synthesised in the proximal intestinal epithelial cells. Somatostatin-28 (sheep, human rat mouse) suppresses glucose-stimulated insulin secretion without affecting circulating basal insulin concentration. Somatostatin-28 (sheep, human rat mouse) also targets to somatostatin receptor subtype 5 (SSTR5) to regulate GLP-1 secretion .
|
- HY-P3899A
-
|
|
Somatostatin Receptor
|
Metabolic Disease
|
|
[Nle8] Somatostatin (1-28) TFA is a derivative of somatosttin (1-28) with norleucine replacing methionine in position 8. [Nle8] Somatostatin (1-28) TFA increases the amylase release.[Nle8] Somatostatin (1-28) TFA increases the cyclic AMP in pancreatic acini .
|
- HY-P4373
-
|
|
Cathepsin
MMP
|
Metabolic Disease
|
|
Hepcidin-1 (mouse) is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) facilitates osteoclast differentiation .
|
- HY-P4373A
-
|
|
Cathepsin
MMP
|
Inflammation/Immunology
|
|
Hepcidin-1 (mouse) TFA is an endogenous peptide hormone involved in the regulation of iron homeostasis. Hepcidin-1 (mouse) TFA upregulates mRNA levels of TRAP, cathepsin K, and MMP-9 and increases TRAP-5b protein secretion. Hepcidin-1 (mouse) TFA downregulates the level of FPN1 protein and increases intracellular iron. Hepcidin-1 (mouse) TFA facilitates osteoclast differentiation .
|
- HY-P2625S1
-
|
|
Isotope-Labeled Compounds
GCGR
|
Metabolic Disease
|
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
- HY-P2625S
-
|
|
Isotope-Labeled Compounds
|
Metabolic Disease
|
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
- HY-P5354
-
|
|
Fluorescent Dye
|
Others
|
|
FRETS-VWF73, a 73-amino-acid peptide, is a fluorogenic substrate for ADAMTS13 assay (Ex=340 nm; Em=450 nm). .
|
- HY-P5833
-
|
κ-Bgt
|
nAChR
|
Neurological Disease
|
|
κ-Bungarotoxin (κ-Bgt) is a potent, selective, and slowly reversible antagonist of α3β2 neuronal nicotinic acetylcholine receptors with an IC50 of 2.30 nM .
|
- HY-P1024
-
|
GLP-2 (human); Glucagon-like peptide 2 (human)
|
GCGR
|
Metabolic Disease
|
|
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
|
- HY-P1841
-
|
|
Endogenous Metabolite
Apoptosis
|
Metabolic Disease
|
|
Glucagon-Like Peptide (GLP) II, human is a 33-amino acid peptide derived from the C-terminal of proglucagon and mainly produced by the intestinal L cells. Glucagon-Like Peptide (GLP) II, human stimulates intestinal mucosal growth and decreases apoptosis of enterocytes .
|
- HY-P1142
-
|
|
Apoptosis
|
Others
|
|
GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
- HY-P1142A
-
|
|
Apoptosis
|
Others
|
|
GLP-2(rat) TFA is an intestinal growth factor. GLP-2(rat) TFA stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) TFA enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR) .
|
- HY-P4835
-
|
|
Phosphatase
|
Others
|
|
pTH (2-34) (human) (80 μg/kg) slightly increases serum osteocalcin levels and alkaline phosphatase activity of bone extract (markers of bone formation) in mice. pTH (2-34) is not as effective as pTH (1-34) .
|
- HY-P10309
-
|
[Nle8'18,Tyr34]hPTH (3-34) amide
|
Peptides
|
Endocrinology
|
|
[Nle8,18,Tyr34]-pTH (3-34) amide human ([Nle8,18,Tyr34]hPTH (3-34) amide) is a parathyroid hormone (PTH) analog .
|
- HY-P10654
-
- HY-P0059
-
|
Human parathyroid hormone-(1-34); hPTH (1-34)
|
PTHR
Thyroid Hormone Receptor
|
Others
Cancer
|
|
Teriparatide (Human parathyroid hormone-(1-34)) is a PTH1 receptor agonist. Teriparatide (Human parathyroid hormone-(1-34)) can be used for osteoporosis research .
|
- HY-P4673
-
|
|
Peptides
|
Others
|
|
(Nle8,18,Tyr34)-pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4710
-
|
|
Peptides
|
Others
|
|
(Tyr1)-pTH (1-34) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1142S1
-
|
|
Isotope-Labeled Compounds
Apoptosis
|
Others
|
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
- HY-P1142S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
- HY-P4862
-
|
|
PTHR
|
Others
|
|
Biotinyl-pTH (1-34) (human) is abiotinylated Teriparatide (HY-P0059).
|
- HY-P4839
-
|
|
Peptides
|
Metabolic Disease
|
|
GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes .
|
- HY-P5719
-
|
|
Bacterial
|
Infection
|
|
Andropin is a male-specific antibacterial peptide that can be found in Drosophila melanogaster .
|
- HY-P10844
-
|
|
Amino Acid Derivatives
|
Cancer
|
|
ANK peptide is a novel peptide designed based on the conserved residues of single ankyrin motif. ANK peptide is a synuclein-γ (SNCG) inhibitor that binds to SNCG and competes with SNCG-BubR1 interaction to enhance the sensitivity of breast cancer cells to antimicrotubule drugs such as nocodazole and paclitaxel. ANK peptide can be used in the study of cancer .
|
- HY-P2510
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
Parathyroid Hormone (1-34), human, biotinylated is a probe for the parathyroid hormone receptor, can be used for analyzing the interaction between parathyroid hormone and parathyroid hormone receptors in living cells and for purifying hormone-receptor complexes with affinity columns .
|
- HY-P4821
-
|
|
Peptides
|
Others
|
|
pTH (1-34) amide (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5157
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BmP02 is a selective Kv1.3 channel blocker and a highly-selective Kv4.2 modulator, which can be isolated from Chinese scorpion (Buthus martensi Karsch) venom. BmP02 also delays the inactivation of Kv4.2 in HEK293T cells, with an EC50 value of ~850 nM. BmP02 inhibits the transient outward potassium currents (Ito) in ventricular muscle cells .
|
- HY-P4823
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
pTH (1-37) (human) is a fragment of parathyroid hormone (PTH). pTH (1-37) (human) induces the cAMP formation and increases alkaline phosphatase activity. pTH (1-37) (human) increases growth, bone calcium content, and bone mineral density (BMD) in uremic animals. pTH (1-37) (human) has the potential for the research of osteoporosis .
|
- HY-P4838
-
|
|
Peptides
|
Others
|
|
pTH (2-38) (human) is involved in the anabolic action of bone. PTH (2-38) can increase the level of serum INS-PTH (complete N-terminal specific PTH) .
|
- HY-P0052
-
|
T20; DP178
|
HIV
|
Infection
|
|
Enfuvirtide (T20;DP178) is an anti-HIV-1 fusion inhibitor peptide.
|
- HY-P0052A
-
|
T20 acetate; DP178 acetate
|
HIV
|
Infection
|
|
Enfuvirtide (T20; DP178) acetate is an anti-HIV-1 fusion inhibitor peptide.
|
- HY-P4825
-
|
|
Peptides
|
Others
|
|
pTH (1-38) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P10622
-
|
|
Apoptosis
Reactive Oxygen Species
|
Metabolic Disease
Cancer
|
|
SHLP-3 is a mitochondrial derived peptide encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP-3 increases cell viability and reduces apoptosis in insulinoma NIT-1β cells and human prostate cancer 22Rv1 cells. SHLP-3 increases mitochondrial function and exerts cytoprotective effects by increasing mitochondrial oxygen consumption rate (OCR), cellular ATP and reducing the ability to produce ROS. SHLP-3 can be used in the study of diabetes and cancer .
|
- HY-P4829
-
|
|
Peptides
|
Others
|
|
pTH (1-84) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5625
-
|
|
Bacterial
|
Infection
|
|
ROAD-1 is an oral mucosal α-defensin of Rhesus Macaque. ROAD-1 is active against S. aureus, E. coli, and C. albicans .
|
- HY-P0203
-
|
CGRP (83-119), mouse, rat
|
CGRP Receptor
|
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
|
|
α-CGRP (mouse, rat), a neuropeptide (calcitonin gene-related peptide (CGRP)) mainly expressed in neuromuscular junction, is a potent vasodilator. α-CGRP (mouse, rat) can lead to a fall in blood pressure and an increase in heart rate by peripheral administration, also relax colonie smooth muscle. α-CGRP (mouse, rat) has the potential in cardiovascular, pro-inflammatory, migraine and metabolic studies .
|
- HY-P1071
-
|
Calcitonin gene-related peptide
|
CGRP Receptor
|
Cardiovascular Disease
|
|
α-CGRP(human) is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) is a potent vasodilator .
|
- HY-P1071A
-
|
Calcitonin gene-related peptide TFA
|
CGRP Receptor
|
Cardiovascular Disease
|
|
α-CGRP(human) TFA is a regulatory neuropeptide of 37 amino acids. α-CGRP(human) is widely distributed in the central and peripheral nervous system. α-CGRP(human) TFA is a potent vasodilator .
|
- HY-P2542
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo .
|
- HY-P4058
-
|
CGRP free acid
|
Peptides
|
Neurological Disease
|
|
Calcitonin gene-related peptide (CGRP) free acid is a neuropeptide. Calcitonin gene-related peptide can be used for the research of nociception, ingestive behaviour and modulation of the endocrine systems .
|
- HY-P4086
-
|
|
RABV
|
Infection
|
|
Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R), a chimeric peptide consisting of 29 amino acids, is synthesized by adding nona-arginine motif to the carboxy terminus of RVG (rabies virus glycoprotein). Chimeric Rabies Virus Glycoprotein Fragment (RVG-9R) is positively charged and able to bind negatively charged nucleic acids via charge interaction .
|
- HY-P2949
-
|
|
Potassium Channel
|
Cancer
|
|
Pandinotoxin Kα, isolated from the venom of Pandinus imperator, is the inhibitor of A-type potassium channel .
|
- HY-P1218B
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Phrixotoxin 3-NH2 TFA is a derivative of Phrixotoxin 3 TFA (HY-P1218A). Phrixotoxin 3 TFA is a potent blocker of voltage-gated sodium channels, with IC50s of 0.6, 42, 72, 288, 610 nM for NaV1.2, NaV1.3, NaV1.4, NaV1.1 and NaV1.5, respectively. Phrixotoxin 3 TFA modulates voltage-gated sodium channels with properties similar to those of typical gating-modifier toxins, both by causing a depolarizing shift in gating kinetics and by blocking the inward component of the sodium current .
|
- HY-P0276
-
|
Gastric Inhibitory Peptide (GIP), human
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
- HY-P1548
-
|
Human β-CGRP; CGRP-II (Human)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human (Human β-CGRP) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P1548A
-
|
Human β-CGRP TFA; CGRP-II (Human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human TFA (Human β-CGRP TFA) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P1913
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II can be used in the research of cardiovascular diseases .
|
- HY-P1913A
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Calcitonin Gene Related Peptide (CGRP) II, rat TFA, a CGRP receptor activator, is a potent and long-lasting vasodilator. Calcitonin Gene Related Peptide (CGRP) II TFA can be used in the research of cardiovascular diseases .
|
- HY-P1548B
-
|
Human β-CGRP acetate; CGRP-II (Human) (acetate)
|
CGRP Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
β-CGRP, human acetate (Human β-CGRP acetate) is one of calcitonin peptides, acts via the complex of calcitonin-receptor-like receptor (CRLR) and receptor-activity-modifying protein (RAMP), with IC50s of 1 nM and 300 nM for CRLR/RAMP1 and CRLR/RAMP2 in cells .
|
- HY-P0276A
-
|
Gastric Inhibitory Peptide (GIP), human TFA
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP, human TFA, a peptide hormone consisting of 42 amino acids, is a stimulator of glucose-dependent insulin secretion and a weak inhibitor of gastric acid secretion. GIP, human TFA acts as an incretin hormone released from intestinal K cells in response to nutrient ingestion .
|
- HY-P1410
-
|
|
TRP Channel
Piezo Channel
|
Cardiovascular Disease
Neurological Disease
Inflammation/Immunology
|
|
GsMTx4 is a spider venom peptide that selectively inhibits cationic-permeable mechanosensitive channels (MSCs) belonging to the Piezo and TRP channel families. GsMTx4 also blocks cation-selective stretch-activated channels (SACs) , attenuates lysophosphatidylcholine (LPC)-induced astrocyte toxicity and microglial reactivity. GsMTx4 is an important pharmacological tool for identifying the role of these excitatory MSCs in normal physiology and pathology .
|
- HY-P3580
-
|
Human N-acetyl GIP
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) can be used for research of diabetes, insulin resistance and obesity .
|
- HY-P3584
-
|
(Pro3) Gastric Inhibitory Peptide, human
|
Insulin Receptor
|
Metabolic Disease
|
|
(Pro3) GIP, human ((Pro3) Gastric Inhibitory Peptide, human) is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human has high binding affinity for human GIPR with Ki/ Kd values of 0.90 nM. (Pro3) GIP, human can be used for the research of obesity-related diabetes .
|
- HY-P4946
-
|
|
Peptides
|
Others
|
|
Biotinyl-α-CGRP (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4941
-
|
|
Peptides
|
Others
|
|
Biotinyl-α-CGRP (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3580A
-
|
Human N-acetyl GIP TFA
|
Insulin Receptor
|
Metabolic Disease
Endocrinology
|
|
Acetyl Gastric Inhibitory Peptide (human) TFA is a fatty acid derivatized analog of glucose-dependent insulinotropic polypeptide with improved antihyperglycaemic and insulinotropic properties. Acetyl Gastric Inhibitory Peptide (human) TFA can be used for research of diabetes, insulin resistance and obesity .
|
- HY-P5390
-
|
|
Peptides
|
Others
|
|
GIP, rat is a biological active peptide. (GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.)
|
- HY-P5865
-
|
Theraphotoxin-Tap1a; TRTX-Tap1a; µ/ω-TRTX-Tap1a
|
Sodium Channel
|
Neurological Disease
|
|
Tap1a (Theraphotoxin-Tap1a) is a spider venom peptide that inhibits sodium channels with IC50s of 80 nM and 301 nM against Nav1.7 and Nav1.1, respectively. Tap1a shows analgesic effects .
|
- HY-P1410B
-
- HY-P3247
-
|
|
Insulin Receptor
|
Neurological Disease
Metabolic Disease
|
|
[D-Ala2]-GIP (human) is a GIP receptor agonist. [D-Ala2]-GIP (human) improves glucose tolerance. [D-Ala2]-GIP (human) shows neuroprotective activity in MPTP-induced Parkinson's disease model. [D-Ala2]-GIP (human) also improves cognitive function and hippocampal synaptic plasticity in obese diabetic rats. [D-Ala2]-GIP (human) can be used for research of type 2 diabetes, Parkinson's disease, etc
|
- HY-P5059
-
- HY-P5390A
-
|
|
Peptides
|
Others
|
|
GIP, rat TFA is a bioactive peptide of rat origin. (GIP (glucose-dependent insulinotropic polypeptide or also known as gastric inhibitory polypeptide) is a 42-amino acid peptide released by K cells in the duodenum and jejunum in response to food intake. GIP and GLP (gastric-like peptide) are both intestinal A member of the insulinotropic hormone peptide family that stimulates insulin secretion from pancreatic beta cells and appears to also promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and may play a role in the pathogenesis of obesity function in the mechanism.
|
- HY-P1410C
-
- HY-P3584A
-
|
(Pro3) Gastric Inhibitory Peptide, human TFA
|
Insulin Receptor
|
Metabolic Disease
|
|
(Pro3) GIP, human TFA is an efficacious, stable and specific human GIP receptor (hGIPR) full agonist. (Pro3) GIP, human TFA has high binding affinity for human GIPR with Ki/ Kd value of 0.90 nM. (Pro3) GIP, human TFA human can be used for the research of obesity-related diabetes .
|
- HY-P2601A
-
|
|
Peptides
|
Others
|
|
Tyr-α-CGRP (human) TFA is an N-terminally extended human α-CGRP analog. Tyr-α-CGRP (human) TFA can bind to membrane preparations from rat brain and spleen with IC50 values of 0.2 nM and 0.5 nM, respectively, and induce positive chronotropic and inotropic effects in isolated guinea pig right and left atria with EC50 values of 282 nM and 74 nM, respectively. Tyr-α-CGRP (human) TFA also inhibits contractile responses in rat vas deferens with an EC50 value of 1.9 nM .
|
- HY-P0191
-
- HY-P0191A
-
- HY-P5184
-
|
HNTX-IV
|
Sodium Channel
|
Neurological Disease
|
|
Hainantoxin-IV is a specific antagonist of Sodium Channel, targeting to tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels. His28 and Lys32 are the key resiudes of Hainantoxin-IV for binding with target, while Hainantoxin-IV adopts an inhibitor cystine knot motif .
|
- HY-P5854
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Aa1 toxin, a neurotoxic peptide that can be obtained from the venom of Androctonus australis Garzoni, is a specific potassium channel blocker. Aa1 toxin can be used in the study of neurological diseases .
|
- HY-P4692
-
- HY-P2289
-
|
pBD-1
|
Bacterial
|
Infection
|
|
β-defesin 1 (pig) (pBD-1) is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P1022
-
|
Metastin(human)
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Kisspeptin-54(human) (Metastin(human)) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) hinders tumor metastasis and stimulates gonadotropin secretion .
|
- HY-P1022A
-
|
Metastin(human) TFA
|
GnRH Receptor
|
Endocrinology
Cancer
|
|
Kisspeptin-54(human) TFA (Metastin(human) TFA) is an endogenous ligand for kisspeptin receptor (KISS1, GPR54). Kisspeptin-54(human) TFA binds to rat and human GPR54 receptors with Ki values of 1.81 nM and 1.45 nM, respectively. Kisspeptin-54(human) TFA hinders tumor metastasis and stimulates gonadotropin secretion .
|
- HY-P1189
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P1189A
-
|
|
Integrin
|
Metabolic Disease
Inflammation/Immunology
|
|
Echistatin TFA, the smallest active RGD protein belonging to the family of disintegrins that are derived from snake venoms, is a potent inhibitor of platelet aggregation. Echistatin is a potent inhibitor of bone resorption in culture. Echistatin is a potent antagonist of αIIbβ3, αvβ3 and α5β1 .
|
- HY-P1455
-
|
Human adrenomedullin-(1-52)-NH2
|
Peptides
|
Cancer
|
|
Adrenomedullin (AM) (1-52), human is a 52-amino acid peptide, which affects cell proliferation and angiogenesis in cancer.
|
- HY-P1455A
-
|
Human adrenomedullin-(1-52)-NH2 TFA
|
Peptides
|
Cancer
|
|
Adrenomedullin (AM) (1-52), human (TFA) affects cell proliferation and angiogenesis in cancer.
|
- HY-P3479
-
- HY-P5551
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
TLN-58 is an antimicrobial peptide. TLN-58 has antibacterial activity against S. aureus, S. epidermidis, and group A Streptococcus. TLN-58 also induces inflammatory cytokine mRNAs upregulation in normal human keratinocytes and NCL-SG3 cells .
|
- HY-P5078
-
|
|
Peptides
|
Infection
|
|
NPNA hexamer is a peptide. NPNA hexamer can be used for the research of malaria and the development of a sporozoite vaccine .
|
- HY-P5151
-
|
|
Peptides
|
Others
|
|
LiTx3 is a lethal and cysteine-rich peptide. LiTx3 can be isolated from L. intermedia crude venom. LiTx3 induces flaccid paralysis in Spodoptera frugiperda larvae .
|
- HY-P0277
-
|
CEA peptide
|
Peptides
|
Cancer
|
|
Carcinoembryonic antigen peptide 1 (CEA peptide) is a carcinoembryonic antigen (CEA)-derived peptide. Carcinoembryonic antigen peptide 1 is a potential HLA-A*0201-restricted CTL epitope that can be used for the study of CTL-mediated epithelial-derived cancers .
|
- HY-P1788
-
|
|
Influenza Virus
|
Infection
|
|
Influenza A NP(366-374) Strain A/PR/8/35 is an H2-Db-restricted epitope from Influenza A/PR/8/35 nucleoprotein .
|
- HY-P3429A
-
|
|
PKC
|
Cardiovascular Disease
|
|
SAMβA TFA is conjugated to the cell permeable peptide TAT47-57. SAMβA TFA, a rationally designed selective antagonist of Mfn1-βIIPKC association. SAMβA TFA is a selective inhibitor of mitofusin 1-βIIPKC association improves heart failure outcome in rats .
|
- HY-P2006
-
|
|
Peptides
|
Others
|
|
Abecomotide is a biological active peptide. (an immunological agent for active immunization)
|
- HY-P5501
-
|
|
Peptides
|
Others
|
|
Influenza A NP (366-374) is a biological active peptide. (H-2Db restricted CTL epitope)
|
- HY-P10561
-
|
|
Peptides
|
Cancer
|
|
CPK peptide is a tumor-localizing peptide. CPK peptide specifically binds to the monocarboxylate transporter 1 (MCT1) receptor, which is overexpressed in many human colon cancer cell lines but not in normal cells. CPK peptide can be used in tumor diagnosis research .
|
- HY-P10535
-
|
|
Peptides
|
Others
|
|
The AAV-8 NSL epitope is a specific CD8+ T cell epitope identified from the capsid of an adeno-associated virus (AAV) serotype 8. The AAV-8 NSL epitope has a high affinity for MHC I molecules and is able to bind to MHC I molecules, thereby activating CD8+ T cells. The AAV-8 NSL epitope can be used to study the impact of T cell-mediated immune responses on AAV-mediated gene transfer .
|
- HY-P2590
-
|
|
Peptides
|
Others
|
|
Tnrnflrfamide is a neuropeptide that modulates the receptor muscles of the lobster abdominal stretch receptors and their exoskeletal muscle homologues. Tnrnflrfamide enhances motor performance, including the amplitude of excitatory postsynaptic potentials and the development of nerve-evoked tension .
|
- HY-P10689
-
|
|
SARS-CoV
|
Infection
|
|
NQK-A8 peptide is an immunodominant peptide of seasonal coronaviruses HKU1-CoV and OC43-CoV .
|
- HY-P10688
-
- HY-P1890
-
|
|
EBV
|
Infection
|
|
CEF14, EBV Rta Protein (28-37) is the HLA A24-restricted epitope from Epstein-Barr Virus Rta protein (28-37).
|
- HY-P4873
-
|
|
Peptides
|
Neurological Disease
|
|
Amylin (20-29) (human) is the fragment of human islet amyloid polypeptide (hIAPP) or Amylin. Amylin is a 37-residue hormone. Amylin (20-29) (human) is responsible for the amyloidogenic propensities of the full length protein. Amylin (20-29) (human) can be transformed into its corresponding peptoid and retropeptoid sequences, to obtain beta-sheet breaker peptides as amyloid inhibitors .
|
- HY-P3199
-
|
|
PKC
|
Inflammation/Immunology
|
|
PKCβII Peptide Inhibitor I is a PKCβII inhibitor. PKCβII Peptide Inhibitor I shows cardioprotective effects in rat cardiac Ischemia/reperfusion injury model. PKCβII Peptide Inhibitor I also prevents vascular endothelial dysfunction .
|
- HY-P10710
-
|
|
IFNAR
Interleukin Related
COX
|
Inflammation/Immunology
|
|
BMP-4 is a penetrating heparin-binding peptide with anti-inflammatory and anti-chondrogenic functions. In murine chondrocytes and macrophages, BMP-4 regulates the iNOS-IFN-IL6 signaling pathway to inhibit the expression of inflammatory proteins such as iNOS, COX2, IFN, and IL6 in a dose-dependent manner, effectively suppressing inflammation and alleviating various arthritis symptoms .
|
- HY-P0017
-
- HY-P2289A
-
|
pBD-1 TFA
|
Bacterial
|
Infection
|
|
β-defesin 1 (pig) (pBD-1) TFA is an endogenous and constitutively expressed antimicrobial peptide (AMP) from porcine tissues, particularly expresses in pig mucosal epithelial sites. β-defesin 1 (pig) TFA has antimicrobial activities and contributes to mucosal and systemic host defenses in pigs .
|
- HY-P5798
-
|
FAS-I
|
Cholinesterase (ChE)
|
Neurological Disease
|
|
Fasciculin-I is isolated from the mambas venom. Fasciculin-I exerts its toxic effects by inhibiting acetylcholinesterase (AChE). Fasciculin-I blocks α-neurotoxins of nicotinic acetylcholine receptors and cardiac toxins that interact with cell membranes .
|
- HY-108814
-
|
DX-88
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) is a specific plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide can be used to prevent acute attacks of angioedema .
|
- HY-108814A
-
|
DX-88 TFA
|
Kallikrein
|
Cardiovascular Disease
|
|
Ecallantide (DX-88) TFA is a specific recombinant plasma kallikrein inhibitor. Ecallantide inhibits the production of bradykinin. Ecallantide may be used to prevent acute attacks of angioedema .
|
- HY-P0254
-
|
|
Kisspeptin Receptor
|
Cardiovascular Disease
Cancer
|
|
Kisspeptin-10, human is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10, human acts as a tumor metastasis suppressor via its receptor GPR54. Kisspeptin-10-GPR54 system plays an important role in embryonic kidney development. Kisspeptin-10/GPR54 signaling induces osteoblast differentiation via NFATc4-mediated BMP2 expression .
|
- HY-P1197A
-
|
|
Kisspeptin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Kisspeptin-10 (mouse, rat) TFA is a potent vasoconstrictor and inhibitor of angiogenesis. Kisspeptin-10 (mouse, rat) TFA is a ligand for the rodent kisspeptin receptor (KISS1, GPR54). Kisspeptin-10 (mouse, rat) TFA reduces Methotrexate-induced reproductive toxicity as a potential antioxidant compound .
|
- HY-P4628
-
|
LRH-1 peptide
|
Peptides
|
Inflammation/Immunology
|
|
TPNQRQNVC is a nonapeptide and is the epitope of HLA-B0702. TPNQRQNVC induces a CD8+ T cell immune response .
|
- HY-P4190
-
|
|
GnRH Receptor
|
Endocrinology
|
|
FSH receptor-binding inhibitor fragment(bi-10) is a potent FSH antagonist. FSH receptor-binding inhibitor fragment(bi-10) blocks the binding of FSH to FSHR, and alteres FSH action at the receptor level. FSH receptor-binding inhibitor fragment(bi-10) results in the suppression of ovulation and causes follicular atresia of mice. FSH receptor-binding inhibitor fragment(bi-10) has the potential for utilizing to restrain the carcinogenesis of ovarian cancer by down-regulating overexpression of FSHR and ERβ in the ovaries .
|
- HY-P5371
-
|
|
Thrombin
|
Others
|
|
TFLLRNPNDK-NH2 is a biological active peptide. (This peptide is a thrombin receptor activating peptide. This PAR-1 agonist peptide reversibly binds to PAR-1 mimicking the 'tethered ligand' that thrombin makes available through proteolytic cleavage of substrate. It is also known to cause increase in liquid and protein permeability much like thrombin.)
|
- HY-P5516
-
|
|
Peptides
|
Others
|
|
SNNF(N-Me)GA(N-Me)IL is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)
|
- HY-163425S
-
- HY-P10256
-
|
|
Kisspeptin Receptor
PKA
PKC
|
Endocrinology
|
|
Kiss2 peptide is a positive regulator of reproduction. Kiss2 peptide binds with its cognate receptor Kiss2R (GPR54) in COS-7 cells, activates PKA and PKC signaling pathways through Gas and Gaq proteins, and thus enhances the activity of cAMP response element-dependent luciferase (CRE-luc) and serum response element-dependent luciferase (SRE-luc) .
|
- HY-P10419
-
|
|
Kisspeptin Receptor
GnRH Receptor
|
Endocrinology
|
|
Zebrafish Kisspeptin-1 is the core sequence of the neuropeptide kisspeptin-1, which participate in the regulation of gonadotropin-releasing hormone (GnRH) release, and regulates the reproductive system .
|
- HY-P10256A
-
|
|
Kisspeptin Receptor
PKA
PKC
|
Endocrinology
|
|
Kiss2 peptide acetate is the acetate form of Kiss2 pepride (HY-P10256). Kiss2 peptide acetate is a positive regulator of reproduction. Kiss2 peptide acetate binds with its cognate receptor Kiss2R (GPR54) in COS-7 cells, activates PKA and PKC signaling pathways through Gas and Gaq proteins, and thus enhances the activity of cAMP response element-dependent luciferase (CRE-luc) and serum response element-dependent luciferase (SRE-luc) .
|
- HY-P1557
-
|
1-12-Somatostatin-28
|
Peptides
|
Neurological Disease
|
|
Somatostatin-28 (1-12) is a somatostatin fragment that is monitored in brain tissue to track processing of somatostatin.
|
- HY-P4092
-
|
|
Peptides
|
Cancer
|
|
HN-1 is a 12-mer peptide with specific activity to head and neck squamous cell cancer (HNSCC) cells. HN-1, as a tumor-specific peptide, is capable of penetrating tumor tissues. HN-1 is capable of translocating agents across cell membranes .
|
- HY-P1196
-
- HY-P1196A
-
- HY-P5412
-
|
Listeriolysin O 190 peptide
|
Peptides
|
Others
|
|
LLO (190-201) (Listeriolysin O 190 peptide) is a biological active peptide. (This peptide is a major histocompatibility complex class II (MHC-II)-restricted peptide, LLO190 (NEKYAQAYPNVS), from the listeriolysin O protein of Listeria monocytogenes, which generates an LLO190-specific Th response. This peptide subsequently challenge recombinant L. monocytogenes expressing the MHC-I-restricted epitope of ovalbumin (Ova257, SIINFEKL).)
|
- HY-P5951
-
- HY-P10670
-
|
|
Peptides
|
Others
|
|
CLE25 peptide moves from the roots to the leaves and modulates NCED3 expression in leaves in association with the receptor-like kinases BAM1 and BAM3. CLE25 peptide induces stomatal closure by modulating abscisic acid accumulation and thereby enhances resistance to dehydration stress .
|
- HY-P10849
-
|
|
Calcium Channel
|
Others
|
|
IP3RPEP6 is an IP3R competitive inhibitor. IP3RPEP6 has the IC50 values of 9.0 μM, 3.9 μM and 4.3 μM for IP3R1, IP3R2 and IP3R3, respectively. IP3RPEP6 does not affect the Ryanodine receptor and Cx43 hemichannels. IP3RPEP6 regulates calcium signaling within cells .
|
- HY-P4062
-
|
BIL
|
Insulin Receptor
|
Metabolic Disease
|
|
Insulin peglispro (BIL) is a basal insulin with a flat, prolonged activity profile. Insulin peglispro can exhibit better glycaemic control compared to conventional insulins .
|
- HY-P1583
-
- HY-P1736
-
|
|
Influenza Virus
|
Infection
|
|
Influenza HA (126-138) is a influenza virus hemagglutinin (HA) peptide comprising amino acids 126-138, induces thymic and peripheral T-cell apoptosis .
|
- HY-P5517
-
|
|
Peptides
|
Others
|
|
SNNF(N-Me)GA(N-Me)ILSS is a biological active peptide. (Double N-methylated derivatives of amyloidogenic and cytotoxic partial IAPP sequence)
|
- HY-P10637
-
|
|
Peptides
|
Others
|
|
Orcokinin (NFDEIDRSGFGFN) is a crustacean peptide eliciting potent myotropic effects in gut tissues. The first Orcokinin reported was NFDEIDRSGFGFN, isolated from abdominal nerve cord extracts of the crayfish Orconectes limosus .
|
- HY-P10672
-
- HY-P0308
-
|
|
Peptides
|
Cardiovascular Disease
|
|
[Glu1]-Fibrinopeptide B is derived from fibrinopeptide B amino acid residues 1-14. Human fibrinopeptide B (hFpB), a thrombin-derived proteolytic cleavage product of the fibrinogen B beta-chain, to stimulate neutrophils (PMN), monocytes, and fibroblasts.
|
- HY-P1493
-
|
FPB,human
|
Peptides
|
Inflammation/Immunology
|
|
Fibrinopeptide B, human is a 14-aa peptide, released from the amino-terminus of β-chains of fibrinogen by thrombin.
|
- HY-P1499
-
- HY-P1493A
-
|
FPB,human TFA
|
Peptides
|
Inflammation/Immunology
|
|
Fibrinopeptide B, human TFA (FPB,human TFA), human is a 14-aa peptide, released from the amino-terminus of β-chains of fibrinogen by thrombin .
|
- HY-P1342
-
|
|
Peptides
|
Neurological Disease
|
|
Prosaptide Tx14(A), a prosaposin-derived peptide, is a potent GPR37L1 and GPR37 agonist with EC50s of 5 and 7 nM, respectively. Prosaptide Tx14(A) increases both ERK1 and ERK2 phosphorylation in Schwann cells .
|
- HY-P1342A
-
|
|
ERK
|
Neurological Disease
|
|
Prosaptide Tx14(A) TFA, a prosaposin-derived peptide, is a potent GPR37L1 and GPR37 agonist with EC50s of 5 and 7 nM, respectively. Prosaptide Tx14(A) TFA increases both ERK1 and ERK2 phosphorylation in Schwann cells .
|
- HY-P5595
-
|
|
Bacterial
|
Infection
|
|
Temporin C is an antimicrobial peptide against Legionella pneumophila .
|
- HY-P10635
-
|
|
Peptides
|
Inflammation/Immunology
|
|
TKD (450-463) is a 14-mer peptide (TKDNNLLGRFELSG). TKD (450-463) is able to stimulate the cytolytic and proliferative activity of NK cells at concentrations equivalent to full-length Hsp70 protein .
|
- HY-P4358
-
|
|
Peptides
|
Others
|
|
LAAVSDLNPNAPR is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4949
-
|
|
Peptides
|
Others
|
|
Tau Peptide (274-288) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4959
-
|
|
Peptides
|
Others
|
|
Tau Peptide (277-291) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5502
-
|
|
Peptides
|
Others
|
|
Influenza NP (311-325) is a biological active peptide. (This peptide is amino acids 311 to 325 fragment of the influenza virus nucleoprotein (NP). This bona fide MHC class II restricted epitope from influenza virus was used to study the host immunoresponse during the infection. This peptide elicits the strongest gamma interferon (IFN-gamma) production in the intracellular cytokine assays. It does not stimulate CD8 T-cells in mice.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5960
-
|
PTBP1 α3-helix derived peptide P6 TFA
|
Peptides
|
Others
|
|
PTBP1-RNA-binding inhibitor P6 (PTBP1 α3-helix derived peptide P6) TFA is a stapled peptide inhibitor of the splicing factor PTBP1, which inhibits alternative splicing events regulated by PTBP1. PTBP1 binds RNA through its RNA recognition motif .
|
- HY-P10247
-
|
|
Mitochondrial Metabolism
|
Neurological Disease
|
|
Amyloid precursor C-terminal peptide is cleaved from the C-terminus of Amyloid Precursor Protein (APP). Amyloid precursor C-terminal peptide accumulation causes mitochondrial morphology alteration and basal mitophagy failure, which indicates that amyloid precursor protein C-terminal peptide may correspond to an etiological trigger of Alzheimer’s disease (AD) pathology .
|
- HY-P10245
-
|
|
RSV
|
Inflammation/Immunology
|
|
Fusion glycoprotein 92-106 is a polypeptide from fusion protein of respiratory syncytial virus (RSV). Fusion glycoprotein 92-106 acts as MHC class I-restricted CTL epitope, that all 15 amino acids are required for efficient recognition by cytotoxic T lymphocyte (CTL) .
|
- HY-P10690
-
|
|
Peptides
|
Neurological Disease
|
|
CCHa1 peptide is a signaling peptide that plays a role in inhibiting sleep arousal. It is produced by enteroendocrine cells in the gut and modulates the animal's response to sensory inputs such as mechanical vibrations by acting on specific dopamine neurons in the brain, thereby helping to suppress arousal responses. CCHa1 peptide holds potential for research in fields related to sleep quality and sensory adaptation .
|
- HY-P1442
-
|
|
Adrenergic Receptor
|
Cancer
|
|
AdTx1 is a selective α1A-adrenoceptor antagonist (Ki: 0.35 nM). AdTx1 can be used for research of benign prostatic hyperplasia .
|
- HY-P5784
-
|
|
Sodium Channel
|
Neurological Disease
|
|
δ-Buthitoxin-Hj1a, a scorpion-venom peptide, is a potent NaV1.1 agonist with an EC50 of 17nM. δ-Buthitoxin-Hj1a can be used for the Dravet syndrome (DS) research .
|
- HY-P5807
-
|
β-Mammal toxin Cn2
|
Sodium Channel
|
Neurological Disease
|
|
Cn2 toxin is aβ- toxoins. Cn2 toxin can bind to the voltage
sensing domain of voltage gated sodium channels (Nav)
.
|
- HY-P5807A
-
|
β-Mammal toxin Cn2 TFA
|
Sodium Channel
|
Neurological Disease
|
|
Cn2 toxin TFA (β-Mammal toxin Cn2 TFA) is a single-chain β-scorpion neurotoxic peptide that is the main toxin in scorpion venom. Cn2 toxin (TFA) specifically targets mammalian voltage-gated sodium channels (VGSC) Nav1.6 .
|
- HY-P1560
-
|
Lysozyme C (46-61) (chicken)
|
Bacterial
|
Infection
|
|
Allergen Gal d 4 (46-61), chicken is a hen egg white lysozyme peptide.
|
- HY-P1892
-
|
|
Peptides
|
Infection
|
|
Competence-Stimulating Peptide-12261, a sixteen peptide, is a fragment of competence-stimulating peptide. Competence-Stimulating Peptide, a quorum-sensing molecule, competence-stimulating peptide (CSP) which inhibits germ tube (GT) formation .
|
- HY-P5959
-
|
|
Peptides
|
Others
|
|
PTBP1α3-helix derived peptide P1 is a polypeptide that inhibits RNA binding .
|
- HY-P10658
-
|
|
Phospholipase
|
Others
|
|
ARF1 (2-17) inhibits both ARF-independent (PLC-β) and ARF-dependent (PLD) pathways. ARF1 (2-17) inhibits GTP-γ-S-stimulated PLD activity, phospholipase C-β (PLC-β), and exocytosis .
|
- HY-P1401
-
|
|
PKC
|
Metabolic Disease
|
|
Protein Kinase C (19-36) is a pseudosubstrate peptide inhibitor of protein kinase C (PKC), with an IC50 of 0.18 μM. Protein Kinase C (19-36) markedly attenuated vascular hyperproliferation and hypertrophy as well as glucose-induced suppression of natriuretic peptide receptor response .
|
- HY-P1873
-
|
|
Peptides
|
Endocrinology
|
|
Phosphorylase Kinase β-Subunit Fragment (420-436) is the β-Subunit fragment (peptide 430-436) of phosphorylase kinase. Phosphorylase kinase is a serine/threonine-specific protein kinase which activates glycogen phosphorylase to release glucose-1-phosphate from glycogen .
|
- HY-P3689
-
|
|
CGRP Receptor
Adenylate Cyclase
|
Others
|
|
[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat is a fragments 22-37 of rat calcitonin gene related peptide (CGRP), targeting CGRP receptor and adenylate cyclase. Calcitonin is mainly produced by thyroid C cells while CGRP is secreted and stored in the nervous system .
|
- HY-156343S1
-
- HY-P10594
-
|
|
Peptides
|
Endocrinology
|
|
Myr-Arf1(2–17) is a sarcosinated peptide that mimics the localization and function of Arf1 protein on the cell membrane. Myr-Arf1(2–17) can be used to study the desensitization mechanism of luteinizing hormone/chorionic gonadotropin receptor (LH/CGR) .
|
- HY-P10815
-
|
|
Apoptosis
Calcium Channel
|
Others
|
|
IP3RCYT is IP3R inhibitory peptide, which can inhibit the binding of cytochrome C to IP3R with an IC50 about 100 nM. IP3RCYT regulates calcium signaling within cells. P3RCYT inhibits apoptosis in HeLa and Jurkat cells treated with Staurosporine (HY-15141) or Membrane-bound Fas ligand (FasL) .
|
- HY-P5079
-
|
|
Peptides
|
Others
|
|
LGLLLRHLRHHSNLLANI (B18) is an 18 amino acid peptide. LGLLLRHLRHHSNLLANI derives from the membrane-associated protein binding. LGLLLRHLRHHSNLLANI shows a high affinity for Cu(2+) ions .
|
- HY-P5721
-
|
|
Bacterial
|
Infection
|
|
Apidaecin IA is an antibacterial peptide that can be found in honeybees .
|
- HY-P10183
-
|
Cys-CD36(139-155)
|
Peptides
|
Inflammation/Immunology
|
|
CD36 Peptide P (139-155), Cys conjugated is a Cys labelled CD36 Peptide, and can inhibit the immunoadsorption of CD36 by OKM5 .
|
- HY-P1765
-
|
|
Peptides
|
Neurological Disease
|
|
Galanin (1-19), human is the 1-19 fragment of the human galanin. Galanin (GAL) is a widely distributed neuropeptide with diverse biological effects including modulation of hormone release, antinociception and modification of feeding behavior .
|
- HY-P2341
-
|
|
LDLR
|
Cancer
|
|
Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
- HY-P1820
-
|
|
Peptides
|
Infection
|
|
SNAP-25 (187-203), a peptide corresponding to residues 187–203 of SNAP-25, is a substrate for botulinum neurotoxin (BoNT)/A and can be used as a substrate for quantifying the activity of BoNT/C1(1-430) .
|
- HY-P4095
-
|
|
CXCR
|
Cancer
|
|
NoxaBH3 is a cysteine-based cross-linked peptide with increased cell permeability and higher inhibitory activity against Mcl-1. NoxaBH3 binds to the endogenous CXCR4 ligand to produce ubiquitin-Noxabh3 conjugate. NoxaBH3 is then delivered to cancer cells .
|
- HY-P4145
-
|
|
Peptides
|
Inflammation/Immunology
Cancer
|
|
Quazomotide is a WT1 class II peptide epitope with sequences of RSDELVRHHNMHQRNMTKL. Quazomotide stimulates a peptide-specific CD4(+) response, to recognize WT1(+) tumor cells. Quazomotide is an immunological agent for active immunization, as well as an antineoplastic agent .
|
- HY-P5664
-
|
|
Peptides
|
Infection
|
|
Maximin S4 is an antimicrobial peptide derived from toad Bombina maxima. Maximin S4 has antibacterial activity against mycoplasma .
|
- HY-P10184
-
|
|
Peptides
|
Inflammation/Immunology
|
|
CD36 Peptide P (93-110), Cys conjugated is a Cys labelled CD36 Peptide, and can block binding of CD36 to immobilized thrombospondin and partially inhibited collagen-induced platelet aggregation .
|
- HY-P10692
-
|
|
Interleukin Related
|
Inflammation/Immunology
|
|
HB-107 is a peptide with wound healing properties. HB-107 promotes the proliferation of keratinocytes and increased leukocyte infiltration at the wound site, and it also stimulates cultured endothelial cells to secrete interleukin 8 (IL-8). HB-107 holds potential for research in the fields of wound healing and inflammation .
|
- HY-P4137
-
|
|
Peptides
|
Others
|
|
Cys(Npys) Antennapedia Peptide, amide is a peptide. Cys(Npys) Antennapedia Peptide, amide can be used for various biochemical studies .
|
- HY-P4156
-
|
|
mAChR
|
Neurological Disease
|
|
VLVNTFCDSCIPKTYWNLGY TFA is an antigenic peptide of M3 muscarinic receptor (M3R). VLVNTFCDSCIPKTYWNLGY TFA can be used in ELISA .
|
- HY-P5911
-
|
|
iGluR
|
Inflammation/Immunology
|
|
GluN1 (359-378) is an anti-N-methyl-D-aspartate
receptor (NMDAR) peptide. GluN1 (359-378) can cross the blood-brain barrier.
GluN1 (359-378) can be used to study anti-NMDAR encephalitis therapy targeting
the immune system .
|
- HY-P5723
-
|
|
Bacterial
|
Infection
|
|
Api137 is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 inhibits protein synthesis by trapping of release factors on the 70S ribosome following hydrolysis of the nascent polypeptide chain .
|
- HY-P1351
-
|
|
Peptides
|
Cancer
|
|
Angiopep-2-cys is a conjugate of Angiopep-2 hydrochloride (HY-P2341) and cysteine. Angiopep-2 hydrochloride is a brain peptide vector. The conjugation of anticancer agents with the Angiopep-2 peptide vector could increase their efficacy in the treatment of brain cancer .
|
- HY-P5723A
-
|
|
Bacterial
|
Infection
|
|
Api137 TFA is an antimicrobial peptide that interferes with bacterial growth by inhibiting translation. Api137 TFA inhibits protein synthesis by trapping of release factors on the 70S ribosome following hydrolysis of the nascent polypeptide chain .
|
- HY-P10354
-
- HY-P1654
-
|
|
Integrin
|
Cancer
|
|
A20FMDV2 is a selective αvβ6 integrin inhibitor (IC50: 3 nM), with an activity 1,000-fold more selective for αvβ6 than for other RGD-directed integrins (αvβ3, αvβ5, and α5β1). A20FMDV2 can be derived from the foot-and-mouth disease virus. A20FMDV2 can be radiolabeled for the PET imaging of αvβ6 integrin-positive tumors .
|
- HY-P4971
-
|
|
Complement System
|
Inflammation/Immunology
|
|
C5a Anaphylatoxin (human) is a pro-inflammatory peptide and a leukocyte chemoattractant. C5a Anaphylatoxin (human) can be used to study inflammation and immunity, such as allergic asthma .
|
- HY-P0149
-
- HY-P0149A
-
- HY-P2265
-
|
|
Ras
|
Cancer
|
|
SAH-SOS1A is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM), directly and independently blocks nucleotide association, impairs KRAS-driven cancer cell viability, and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
- HY-P2265A
-
|
|
Ras
|
Cancer
|
|
SAH-SOS1A TFA is a peptide-based SOS1/KRAS protein interaction inhibitor. SAH-SOS1A TFA binds to wild-type and mutant KRAS (G12D, G12V, G12C, G12S, and Q61H) with nanomolar affinity (EC50=106-175 nM). SAH-SOS1A TFA directly and independently blocks nucleotide association. SAH-SOS1A TFA impairs KRAS-driven cancer cell viability and exerts its effects by on-mechanism blockade of the ERK-MAPK phosphosignaling cascade downstream of KRAS .
|
- HY-P4915
-
|
|
Peptides
|
Others
|
|
Big Endothelin-3 (22-41) amide (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3099
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Uroguanylin (human) is a natural ligand for the Guanylyl Cyclase (GCC) receptor expressed in metastatic colorectal cancer tumors. Uroguanylin (human) has anti-tumor actions in an animal model for human colon cancer .
|
- HY-P5923
-
|
|
CXCR
|
Inflammation/Immunology
|
|
E70K is a CXCL8 C-terminal peptide with a substitution of glutamic acid (E) 70 with lysine (K). E70K can reduce neutrophil adhesion and migration during inflammation .
|
- HY-P6010
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP is a selective αvβ6 binding peptide, and can be used for molecular imaging .
|
- HY-P10300
-
|
IL-8 (54-72)
|
CXCR
|
Inflammation/Immunology
|
|
CXCL8 (54-72) is a C-terminal peptide based on the chemokine CXCL8. CXCL8 (54-72) has an interaction between a long and highly positively charged C-terminal region and a negative charge on the GAG that binds to the GAG. CXCL8 (54-72) can inhibit the adhesion and migration of neutrophils and adhesion of endothelial cells. CXCL8 (54-72) can be used to study chemokines in inflammatory response .
|
- HY-P10593
-
|
|
Peptides
|
Cancer
|
|
Influenza A NP (383-391) (HLA-B27) is a peptide sequence derived from tetanus toxin. Influenza A NP (383-391) (HLA-B27) is a broadly immunogenic CD4+ T helper cell epitope that enhances CD8+ cytotoxic T lymphocyte (CTL) responses. Influenza A NP (383-391) (HLA-B27) can be used in breast cancer research .
|
- HY-108741A
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
|
Plecanatide acetate, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide acetate activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide acetate can be used for the research of chronic idiopathic constipation, and it also shows anti-inflammatory activity in models of murine colitis .
|
- HY-108741
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
Cancer
|
|
Plecanatide, an analogue of Uroguanylin, is an orally active guanylate cyclase-C (GC-C) receptor agonist. Plecanatide activates GC-C receptors to stimulate cGMP synthesis with an EC50 of 190 nM in T84 cells assay. Plecanatide shows anti-inflammatory activity in models of murine colitis .
|
- HY-P4073
-
|
GRN1005; Paclitaxel trevatide
|
Peptide-Drug Conjugate (PDC)
LDLR
|
Cancer
|
|
ANG1005 (Paclitaxel trevatide) is a brain-penetrating peptide-drug conjugate. ANG1005, a taxane derivative, consists of three paclitaxel (HY-B0015) molecules covalently linked to Angiopep-2, designed to cross the blood-brain and blood-cerebrospinal barriers and to penetrate malignant cells via low density lipoprotein receptor-related protein (LRP1) transport system .
|
- HY-P5891
-
|
|
PKC
|
Cardiovascular Disease
|
|
TAT-SAMβA is the peptide consist of RNAENFDRF (SAMβA; HY-P3429) conjugated to the cell penetrating TAT protein-derived peptide TAT47–57. TAT-SAMβA is a selective antagonist of Mfn1-βIIPKC association. TAT-SAMβA protects mouse embryonic fibroblast cells (MEFs) against oxidative stress-induced cytotoxicity .
|
- HY-P4690
-
- HY-P5627
-
|
|
Bacterial
|
Infection
|
|
XT-4 is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-4 has strong activity against E.coli, the vaule of MIC is 18 μM .
|
- HY-P2791
-
|
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Tertiapin (reduced) is a kind of synthesis of melittin, its Cys3-Cys14 and Cys5-Cys18 between containing a disulfide bond. Tertiapin (reduced) is a kind of inward rectifier potassium channels blockers, can block the activity of calcium activates large conductance potassium channels. Tertiapin (reduced) can be used for research in diseases such as rheumatoid arthritis and multiple sclerosis .
|
- HY-P1987
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Mast cell degranulating peptide (28-49) is a depolarizing agent from bee venom, it can raise the content of cGMP level in mouse cerebellar slices .
|
- HY-P1783A
-
|
|
Influenza Virus
|
Infection
|
|
M2e, human TFA, consisting of the 23 extracellular residues of M2 (the third integral membrane protein of influenza A), has been remarkably conserved in all human influenza A. M2e, human TFA is a valid and versatile vaccine candidate to protect against any strain of human influenza A .
|
- HY-P2358
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
PSMα3 is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
|
- HY-P2358A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
PSMα3 TFA is a peptide for manipulating DCs to become tolerogenic for DC vaccination strategies. PSMα3 TFA penetrates and modulates human monocyte-derived DCs by altering the TLR2- or TLR4-induced maturation, inhibiting pro- and anti-inflammatory cytokine production and reducing antigen uptake. PSMα3 TFA is an important toxin released by the most virulent strains of methicillin-resistant Staphylococcus aureus (MRSA) .
|
- HY-P5961
-
- HY-P6009
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP is a cysteine-terminated αvβ6 binding peptide .
|
- HY-P6010A
-
|
|
Integrin
|
Cancer
|
|
αvβ6-BP TFA is a selective αvβ6 binding peptide, and can be used for research of molecular imaging .
|
- HY-P10574
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
Phosphorylated CHKtide is a synthetic peptide substrate derived from CDC25C, which is phosphorylated by CHK1/CHK2 in one of the DNA repair pathways. Phosphorylated CHKtide is used in the assays of cell cycle checkpoint kinases 1 and 2 (CHK1/CHK2) and salt-inducible kinases (SIKs) .
|
- HY-P10587
-
|
JNJ-77242113; JNJ-2113; PN-235
|
Interleukin Related
STAT
|
Inflammation/Immunology
|
|
Icotrokinra (JNJ-77242113) is an orally available, selective antagonist of the IL-23 receptor. Icotrokinra inhibits IL-23-induced STAT3 phosphorylation in peripheral blood mononuclear cells (IC50=5.6 pM) and inhibits IL-23-induced interferon IFN-γ production in NK cells with an IC50 of 18.4 pM. In addition, Icotrokinra exhibits anti-inflammatory activity in a rat TNBS-induced colitis model. Icotrokinra can be used in the study of psoriasis, psoriatic arthritis, and inflammatory bowel disease .
|
- HY-P10821
-
|
|
PKC
Reactive Oxygen Species
|
Cardiovascular Disease
|
|
Myr-Tat-PKCβII is a cell permeable protein kinase C β II peptide inhibitor. Myr-Tat-PKCβII mitigates the generation of reactive oxygen species in rat ex-vivo and porcine in-vivo ischemia-reperfusion injury .
|
- HY-P4827
-
|
|
Peptides
|
Others
|
|
pTH (1-84) (dog) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1238
-
|
Neuromedin U (rat); Rat neuromedin U-23
|
Peptides
|
Neurological Disease
|
|
Neuromedin U, rat is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception.
|
- HY-P1238A
-
|
Neuromedin U (rat) TFA; Rat neuromedin U-23 TFA
|
Neuromedin U Receptor
|
Neurological Disease
|
|
Neuromedin U, rat TFA is a 23-amino acid brain-gut peptide. Neuromedin U (NMU), through its cognate receptor NMUR2 in the central nervous system, regulates several important physiological functions, including energy balance, stress response, and nociception.
|
- HY-P5281
-
- HY-P5089
-
|
|
Peptides
|
Infection
|
|
Enterotoxin STp (E. coli) is a heat-stable enterotoxin that can be used in vaccine research .
|
- HY-P10250
-
|
|
HIV
|
Inflammation/Immunology
|
|
HIV gp120 308-331 is HIV antigen fragments, that conjugates with keyhole limpet hemocyanin (KLH) and generates specific anti-HIV antibody .
|
- HY-P10467
-
|
|
Peptides
|
Infection
|
|
ALPS1 peptide from ArfGAP1 is a curvature selective peptide from ArfGAP1 ALPS1 motif. Curvature selectivity can be used to develop broad-spectrum antiviral peptides .
|
- HY-P5089A
-
|
|
Peptides
|
Infection
|
|
Enterotoxin STp (E. coli) TFA is a heat-stable enterotoxin that can be used in vaccine research .
|
- HY-P4130
-
|
|
Peptides
|
Cancer
|
|
MPS-Gαi2 is a peptide (membrane-permeable sequence). MPS-Gαi2 can be used for the research of cell adhesion .
|
- HY-P4131
-
|
|
Peptides
|
Others
|
|
MPS-Gαi3 is a cell penetrating peptide that can be used for drug delivery .
|
- HY-P1190
-
|
|
JNK
Apoptosis
|
Inflammation/Immunology
|
|
c-JUN peptide is a cell-permeable c-JUN-JNK interaction inhibitor. c-JUN peptide inhibits serum-induced c-Jun phosphorylation. c-JUN peptide induces apoptosis .
|
- HY-P5690
-
|
|
Bacterial
|
Infection
|
|
Distinctin is an antimicrobial peptide. Distinctin can be isolated from frog skin. Distinctin has antibacterial activity against E. faecalis, P. aeruginosa, S. aureus and E. coli (MIC: 14.5, 28.0, 28.0, 14.5 μM) .
|
- HY-P6009A
-
|
|
Integrin
|
Cancer
|
|
Cys-αvβ6-BP TFA is a cysteine-terminated αvβ6 binding peptide .
|
- HY-P2285
-
- HY-P2479
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Peripheral Myelin Protein P2 (53-78), bovine is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. Peripheral Myelin Protein P2 (53-78), bovine is a T cell epitope for the induction of experimental autoimmune neuritis (EAN) in Lewis rats .
|
- HY-P3517
-
|
β-EP (6-31), human
|
Opioid Receptor
|
Neurological Disease
Endocrinology
|
|
β-Endorphin, an endogenous opioid neuropeptide, is an opioid receptor agonist. β-Endorphin binds preferentially to μ-opioid receptors and is produced in certain neurons of the central and peripheral nervous system and is one of three endorphins produced in humans. β-Endorphin can be used to reduce stress and maintain homeostasis in the body and is involved in neurological pain perception regulation .
|
- HY-P5158
-
|
|
Adrenergic Receptor
|
Others
|
|
Conopeptide rho-TIA is a peptide derived from the venom contained in the predatory sea snail Conus tulipa, has highly selective and noncompetitive inhibitor at human α1B-Adrenergic Receptor. Conopeptide rho-TIA acts a competitive inhibitor at human α1A-Adrenergic Receptor and α1D-Adrenergic Receptor. Conopeptide rho-TIA binds to each subtype and may provide useful information for the development of novel α1-Adrenergic Receptor subtype-selective drugs .
|
- HY-P5163
-
|
|
Peptides
|
Inflammation/Immunology
|
|
NMB-1 is a conopeptide analogue. NMB-1 selectively inhibits sustained mechanically activated currents in sensory neurons (IC50: 1 μM). NMB-1 inhibits mechanical pain. NMB-1 can be used for research of hearing and pressure-evoked pain .
|
- HY-P5436
-
|
|
Peptides
|
Others
|
|
SK-MLCK M13 is a biological active peptide. (M-13 is a peptide that represents CAM-binding domain of Calmodulin (CaM) target proteins. CaM is an ubiquitous Ca2+ binding protein.)
|
- HY-P5887
-
- HY-P4682
-
- HY-P5746
-
|
|
ADC Cytotoxin
Antibiotic
|
Others
|
|
Suicin 65 is a class I type B lantibiotic produced by Streptococcus suis. Suicin 65 is active against all S. suis isolates .
|
- HY-P5054
-
- HY-P10101
-
|
APTscr
|
STAT
|
Others
|
|
APT STAT3, scrambled (APTscr), a control peptide of STAT3-specific aptide (APTSTAT3), does not bind STAT3. APT STAT3, scrambled contains the same trpzip scaffold but with a scrambled sequence in the target-binding site .
|
- HY-P10623
-
|
|
Peptides
|
Cardiovascular Disease
Metabolic Disease
|
|
SHLP-4 is a mitochondrial derived peptide, a biologically active microprotein encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP-4 increases the proliferation of mouse NIT-1 cells. SHLP-4 can be used in the study of diabetes and cardiovascular diseases .
|
- HY-P1915
-
|
|
Peptides
|
Metabolic Disease
|
|
26Rfa, Hypothalamic Peptide, human is a hypothalamic neuropeptide of the RFamide peptide family with orexigenic activity . 26RFa is an orexigenic neuropeptide identified as the endogenous ligand of the orphan G protein-coupled receptor GPR103 .
|
- HY-P1393
-
|
|
Amylin Receptor
|
Endocrinology
|
|
AC 187 is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 has neuroprotective effects .
|
- HY-P1393A
-
|
|
Amylin Receptor
|
Endocrinology
|
|
AC 187 TFA is a potent and orally active amylin receptor antagonist with an IC50 of 0.48 nM and a Ki of 0.275 nM. AC 187 TFA shows more selective for amylin receptor than calcitonin and CGRP receptors. AC 187 TFA has neuroprotective effects .
|
- HY-P1403
-
|
|
Potassium Channel
|
Others
|
|
Tertiapin LQ is a specific and reversible renal outer medullary potassium ROMK1 (Kir1.1) channel inhibitor .
|
- HY-P5892
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin (1-27) (human) is an opioid antagonist that binds μ-, δ-, and κ-opioid receptors with Kis of 5.31, 6.17, and 39.82 nM, respectively. β-Endorphin (1-27) (human) inhibits β-Endorphin (HY-P1502)-induced and etorphine-induced analgesia .
|
- HY-P5736
-
|
|
Bacterial
|
Infection
|
|
Bass hepcidin is an antimicrobial activity against Escherichia coli. .
|
- HY-P5550
-
|
|
Influenza Virus
|
Infection
|
|
Urumin has antiviral activity against the human influenza A virus. Urumin inhibits the growth of PR8 influenza virus (IC50: 3.8 μM). Urumin targets the conserved stalk of H1 hemagglutini, and is effective at neutralizing drug-resistant H1 influenza viruses. Urumin protects naive mice from lethal influenza infection .
|
- HY-P5586
-
|
|
Peptides
|
Infection
|
|
Dermaseptin-B5 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor .
|
- HY-P1343
-
|
|
Peptides
|
Others
|
|
Frog 26RFa is a neuropeptide that can be isolated from frog brain. Frog 26RFa has pro-oxygen activity .
|
- HY-P1275
-
- HY-P1732
-
|
|
Peptides
|
Cancer
|
|
Transportan is a 27 amino acid-long peptide containing 12 functional amino acids from the amino terminus of the neuropeptide galanin and mastoparan in the carboxyl terminus, connected via a lysine. Transportan belongs to cell-penetrating peptides (CPPs) .
|
- HY-P1135A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
M1145 TFA, a chimeric peptide, is a selective galanin receptor type 2 (GAL2) agonist, with a Ki of 6.55 nM. M1145 TFA shows more than 90-fold higher affinity for GAL2 over GAL1 (Ki=587 nM) and a 76-fold higher affinity over GalR3 (Ki=497 nM). M1145 TFA has an additive effect on the signal transduction of galanin .
|
- HY-P5588
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S4 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5686
-
|
|
Bacterial
|
Infection
|
|
Maximin 78 is an antimicrobial peptide. Maximin 78 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 37.5, 4.7, 37.5 μg/mL). Maximin 78 has hemolytic activities against human and rabbit red cells .
|
- HY-P10200
-
|
|
Bacterial
|
Infection
|
|
CP7-FP13-2 is a peptide with antivirulence factor and antibacterial activity. CP7-FP13-2 inhibits the formation of Staphylococcus aureus biofilm and has good antibacterial efficacy in mice .
|
- HY-159192S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
SADDNIKTPAE(Arg- 13C6, 15N4)LLGPLPPSADDNLKT (TFA) is the 13C and 15N labeled isotope of SADDNIKTPAE-LLGPLPPSADDNLKT (TFA) .
|
- HY-P10719
-
|
|
MyD88
|
Infection
Inflammation/Immunology
|
|
Pepinh-MYD is a MyD88 inhibitor that contains a domain sequence from MyD88 TIR and a protein transduction sequence, enabling it to penetrate the cell membrane. Pepinh-MYD interferes with MyD88-mediated TLR signaling pathways, thereby inhibiting related immune responses. It holds potential for studying the role of MyD88 in viral infections .
|
- HY-12537
-
- HY-P1349
-
- HY-P1547
-
|
|
Peptides
|
Neurological Disease
|
|
Somatostatin-25 is a endogenous neuropeptide hormone that shows inhibitory activity against secretion of growth hormone.
|
- HY-P1015
-
|
Vasoactive Intestinal Peptide, guinea pig
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
|
VIP Guinea pig (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
- HY-P1015A
-
|
Vasoactive Intestinal Peptide, guinea pig TFA
|
PACAP Receptor
|
Neurological Disease
Metabolic Disease
|
|
VIP Guinea pig TFA (Vasoactive intestinal peptide), a trophic and mitogenic factor, stimulates growth in whole cultured embryos. VIP Guinea pig functions as a simple gastrointestinal hormone and suggest a possible neurotransmitter function .
|
- HY-P4129
-
|
|
nAChR
|
Others
|
|
Rabies Virus Matrix Protein Fragment (RV-MAT) is a polypeptide. Rabies Virus Matrix Protein Fragment targets the acetylcholine receptor (AChR) that exists on the cell surface .
|
- HY-P4762
-
|
|
Peptides
|
Others
|
|
(TYR34)-PTH (7-34) AMIDE (BOVINE) is a peptide derivative of Parathyroid Hormone (PTH) .
|
- HY-P1133
-
|
Rat galanin(2-29)
|
Peptides
|
Others
|
|
Galanin (2-29) (rat) inhibits rat pancreatic protein and CCK-8-stimulated amylase secretion. Galanin (2-29) (rat) is an GAL2R agonist (Ki: 3.5 nM) .
|
- HY-P10356
-
|
|
TRP Channel
|
Others
|
|
T100-Mut is a cell-permeable peptide whose N-terminus is conjugated with a myristoylated group to enable T100-Mut to penetrate and localize to the inner side of the plasma membrane, thus mimicking the topology of Tmem100-3Q. T100-Mut can alleviate TRPA1-mediated pain .
|
- HY-P1132A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin (1-29)(rat, mouse) TFA is a non-selective galanin receptor agonist, with Kis of 0.98, 1.48 and 1.47 nM for GAL1, GAL2 and GAL3, respectively. Anticonvulsant effect .
|
- HY-P2426
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
(D-Trp12,Tyr34)-pTH (7-34) amide (bovine) is a potent and competitive antagonist of parathyroid hormone (PTH), with a Ki of 69 nM in bovine renal cortical membrane. (D-Trp12,Tyr34)-pTH (7-34) amide (bovine) can be used for growth and development regulation .
|
- HY-P1285
-
|
Con-R
|
iGluR
|
Neurological Disease
|
|
Conantokin R (Con-R) is an NMDA receptor peptide antagonist with an IC50 of 93 nM. Conantokin R binds Zn 2+ and Mg 2+ with Kds of 0.15 μM and 6.5 μM, respectively. Conantokin R shows anticonvulsant activity .
|
- HY-P4927
-
- HY-P5724
-
|
|
Bacterial
|
Infection
|
|
Nv-CATH is an antibacterial peptide of frog origin. Nv-CATH has broad-spectrum antibacterial activity against gram-positive and gram-negative bacteria. Nv-CATH significantly protects mice from fatal infections caused by Staphylococcus aureus. Nv-CATH protects mice from bacterial infection through antimicrobial immunoregulatory duality .
|
- HY-P1128
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin (swine), a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively .
|
- HY-P1128A
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin (swine) TFA, a neuropeptide, consists of 29 amino acids and contains a C-terminal amidated glycine. Galanin (swine) inhibits basal and stimulated insulin secretion both in vivo and in vitro under a variety of experimental conditions. Galanin (swine) TFA is a galanin receptor agonist with pKis of 9.63, 9.49, 9.02, 8.98, 8.01 and 8.14 at human GAL1, rat GAL1, human GAL2, rat GAL2, human GAL3 and rat GAL3 respectively .
|
- HY-P0209
-
- HY-P1502
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
- HY-P1866
-
- HY-P1866A
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin, equine TFA is an endogenous opioid peptide, which binds at high affinity to both μ/δ opioid receptors. β-Endorphin, equine TFA has analgesic properties .
|
- HY-P2260
-
|
|
Autophagy
HIV
|
Infection
|
|
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV) .
|
- HY-P1728
-
|
|
YAP
|
Cancer
|
|
Super-TDU (1-31) is a peptide fragment of Super-TDU. Super-TDU (1-31) is an inhibitor of YAP-TEAD complex. Super-TDU shows potent anti-tumor activity and suppresses tumor growth in gastric cancer mouse model .
|
- HY-P3141
-
- HY-P4817
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
|
|
Human PTH-(1-31) is the 1-31 fragment of human PTH. Human PTH-(1-31) stimulates the release of cAMP and also is a weaker stimulator of the 25-hydroxyvitamin D-1α-hydroxylase. Human PTH-(1-31) induces bone formation without inducing bone resorption. Human PTH-(1-31) has the potential for the research of osteoporosis .
|
- HY-P2260B
-
|
|
HIV
|
Infection
|
|
Tat-beclin 1 scrambled is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
- HY-P2260C
-
|
|
HIV
|
Infection
|
|
Tat-beclin 1 scrambled TFA is the scrambled part and a scrambled control of Tat-beclin 1 (HY-P2260), which is derived from a region of the autophagy protein, beclin 1. beclin 1 induces autophagy via binding human immunodeficiency virus, HIV-1 Nef and interacting with negative regulator GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens, such as HIV-1. Tat-beclin 1 also reduces mortality in mice infected with chikungunya or West Nile virus .
|
- HY-P2046
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
β-Endorphin (rat) is an endogenous opioid neuropeptide and peptide hormone. β-Endorphin (rat) has analgesic activity and also contributes to food intake in satiated rats. β-Endorphin (rat) can be used in the research of neurological diseases such as analgesia and drug addiction .
|
- HY-P4924
-
- HY-W019878
-
|
β-Lipotropin 61-91
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
|
β-Endorphin, rat (β-Lipotropin 61-91), a neuropeptide, is involved in cardiovascular regulation. β-Endorphin, rat induces marked, prolonged muscular rigidity and immobility similar to a catatonic state in rats .
|
- HY-P10408
-
|
|
EGFR
MMP
Calcium Channel
|
Infection
Inflammation/Immunology
|
|
Candidalysin is a cytolytic peptide toxin, which is initially isolated from Candida albicans and exhibits virulent and avirulent characters. Candidalysin activates epithelial cell signaling pathways by interacting with the epithelial growth factor receptor (EGFR) of host cells, activates matrix metalloproteinase (MMP) and calcium flux, resulting in inflammatory responses and recruitment of immune cells. Candidalysin exhibits cytotoxicity by dealing membran damage to host cells .
|
- HY-P1106
-
|
|
CRFR
|
Cardiovascular Disease
|
|
K41498 is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 can be used for hypotension study .
|
- HY-P1106A
-
|
|
CFTR
|
Cardiovascular Disease
|
|
K41498 TFA is a potent and highly selective CRF2 receptor antagonist with Ki values of 0.66 nM, 0.62 nM and 425 nM for human CRF2α, CRF2β and CRF1 receptors respectively. K41498 TFA is an analogues of antisauvagine-30 (aSvg-30), inhibits sauvagine-stimulated cAMP accumulation in hCRF2α- and hCRF2β-expressing cells. K41498 TFA can be used for hypotension study .
|
- HY-P1160A
-
|
|
GCGR
|
Metabolic Disease
|
|
Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes .
|
- HY-P1160
-
|
|
GCGR
|
Metabolic Disease
|
|
Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes .
|
- HY-P4830
-
|
|
Peptides
|
Others
|
|
Acetyl-Tau Peptide (244-274) (Repeat 1 Domain) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4831
-
|
|
Peptides
|
Others
|
|
Acetyl-β-Endorphin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4818
-
- HY-P4968
-
|
|
Peptides
|
Others
|
|
Tau Peptide (337-368) (Repeat 4 Domain) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5272
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Histatin-3 TFA, a 32 amino acid peptide, possesses powerful antimicrobial properties. Histatin-3 TFA behaves as a substrate for proprotein convertase 1 (PC1), being cleaved by this endoprotease primarily at a site carboxy terminal to the single Arg25 residue (HRGYR decrease SN). Histatin-3 TFA is a moderately potent, reversible and competitive inhibitor of the furin-mediated cleavage of the pentapeptide pGlu-Arg-Thr-Lys-Arg-MCA fluorogenic substrate, with an estimated inhibition constant Ki of 1.98 μM .
|
- HY-P1502F
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Biocytin-β-endorphin, human is abiotinylated β-Endorphin, human (HY-P1502). β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
|
- HY-P4696
-
- HY-P4700
-
- HY-P5111
-
|
|
Peptides
|
Neurological Disease
|
|
Myristoyl-(Lys12,27,28)-VIP-Gly-Gly-Thr (free acid) is a high-affinity and selective VPAC2 receptor antagonist .
|
- HY-P10110
-
|
|
Autophagy
|
Neurological Disease
|
|
retro-inverso TAT-Beclin 1 D-amino acid is has higher activity and resistance to proteolytic degradation in vivo compared to L-amino acids peptide. TAT-Beclin 1 can induce autophagy in peripheral tissues in adult mice as well as in the central nervous system of neonatal mice .
|
- HY-P10108
-
|
Hxk2VBD peptide, cell-permeable
|
Hexokinase
|
Neurological Disease
|
|
Hexokinase II VDAC binding domain peptide (Hxk2VBD peptide) is a cell-permeable hexokinase II VDAC binding domain. Hexokinase II VDAC binding domain peptide inhibits mitochondrial localization of hexokinase 2 (HXK2). Hexokinase II VDAC binding domain peptide inhibits neurotrophic factor-directed axon outgrowth .
|
- HY-P1764
-
|
|
Peptides
|
Neurological Disease
|
|
Secretoneurin, rat, a 33-amino acid polypeptide, is generated by proteolytic processing of secretogranin II (SgII). Secretoneurin, rat induces dopamine release in the rat striatum in vivo and in vitro, and it exerts a very strong chemotactic effect on monocytes and eosinophils but not on granulocytes .
|
- HY-P10313
-
|
[Nle8'18,Tyr34]bPTH (3-34) amide
|
Peptides
|
Others
|
|
[Nle8,18,Tyr34]-pTH (3-34) amide (bovine) ([Nle8'18,Tyr34]bPTH (3-34) amide) is an analogue of parathyroid hormone (PTH), and is a competitive inhibitor of PTH-stimulated biological responses in vitro .
|
- HY-P2279
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
Endocrinology
|
|
Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis .
|
- HY-P2279A
-
|
|
Thyroid Hormone Receptor
|
Metabolic Disease
Endocrinology
|
|
Parathyroid hormone (1-34) (rat) (acetate) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis .
|
- HY-P5443
-
|
|
Bacterial
|
Others
|
|
Pyrrhocoricin is a biological active peptide. (Antimicrobial activity against Gram-negative bacteria)
|
- HY-P5714
-
|
|
Bacterial
|
Infection
|
|
Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain .
|
- HY-P2543
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Neuropeptide Y (3-36) (human, rat), a neuropeptide Y (NPY) metabolite formed from dipeptidyl peptidase-4 (DPP4), is a selective Y2 receptor agonist. Neuropeptide Y (3-36) (human, rat) is a NPY metabolite formed from dipeptidyl peptidase-4 (DPP4). Neuropeptide Y (3-36) (human, rat) decreases release of norepinephrine via the Y2 receptor .
|
- HY-P10000
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion .
|
- HY-P5093
-
|
|
Peptides
|
Others
|
|
Cecropin B (free acid) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P2932A
-
|
|
Peptides
|
Neurological Disease
|
|
Cholecystokinin-33 free acid is an analogue of Cholecystokinin (HY-P2932). C-terminal amidation is important for binding of Cholecystokinin to its receptors, and removing the amide group would decrease Cholecystokinin activity. Cholecystokinin-33 free acid can be used to study C-terminal amidation of Cholecystokinin-33 .
|
- HY-P0092
-
- HY-P1601
-
- HY-P2273
-
|
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin (human) is a hypocalcemic hormone. Calcitonin can lower blood calcium levels and inhibit bone resorption. Calcitonin can be used in hypercalcemia or osteoporosis research .
|
- HY-P2250
-
|
ELA-32 negative control
|
Apelin Receptor (APJ)
|
Others
|
|
ELA RR>GG (ELA-32 negative control), an ELABELA (ELA-32 human) mutant peptide, is inactive. ELA RR>GG is a negative control for ELABELA (HY-P2196) .
|
- HY-P2196A
-
|
|
Apelin Receptor (APJ)
|
Cancer
|
|
ELA-32(human) TFA is a potent, high affinity apelin receptor agonist (IC50=0.27 nM; Kd=0.51 nM). ELA-32(human) TFA exhibits no binding GPR15 and GPR25. ELA-32(human) TFA activates the PI3K/AKT pathway and promotes self-renewal of hESCs via cell-cycle progression and protein translation. ELA-32(human) TFA also potentiates the TGFβ pathway, priming hESCs toward the endoderm lineage. ELA-32(human) TFA stimulates angiogenesis in HUVEC cells.
|
- HY-P2196
-
- HY-P2932
-
|
Cholecystokinin-33(human); CCK-33(human)
|
Peptides
|
Metabolic Disease
|
|
Cholecystokinin is a peptide hormone. Cholecystokinin, as a hunger suppressant, inhibits food intake and stimulates the digestion of fat and protein. Cholecystokinin can be used for the research of gastrointestinal system .
|
- HY-P10290
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Neuropeptide Y (human) free acid upregulates the adhesiveness of human endothelial cells for leukocytes. Neuropeptide Y belongs to the pancreatic polypeptide family, plays an important role in circadian rhythms, neurogenesis, and neuroprotection, nociception, feeding behavior, energy regulation, neuronal excitability, emotion, cognition, and stress response .
|
- HY-P10696
-
|
|
Bacterial
Antibiotic
|
Infection
|
|
C16G2 is a specific targeted antimicrobial peptide (STAMP) that targets the cariogenic oral pathogen Streptococcus mutans. C16G2 specifically recognizes and disrupts the bacterial cell membrane, causing small molecule leakage and loss of membrane potential, leading to bacterial killing. Unlike broad-spectrum antimicrobial peptides, C16G2 exhibits higher selectivity and efficacy against Streptococcus mutans .
|
- HY-P10768
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
Ro 25-1553 is a 31 amino acid vasoactive intestinal peptide (VIP) analog, that acts as an agonist for VIP2 receptor (VPAC2 receptor). Ro 25-1553 exhibits a bronchodilator effect in nerve-induced or Carbachol (HY-B1208)-induced tracheal smooth muscle contraction in guinea pig model .
|
- HY-P10842
-
|
|
GLP Receptor
Akt
|
Metabolic Disease
Inflammation/Immunology
|
|
d-GLP-2 E33A is an agonist for the glucagon-like peptide 2 receptor (GLP-2R) with an EC50 of 414 nM. d-GLP-2 E33A can activate GLP-2R and increase the phosphorylation of AKT, but has no stimulative effect on GLP-1R. d-GLP-2 E33A can be used in the study of diseases such as intestinal malabsorption and inflammatory bowel diseases .
|
- HY-P0090
-
|
Salmon calcitonin
|
CGRP Receptor
|
Cancer
|
|
Calcitonin salmon, a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption.
|
- HY-P0198
-
- HY-P0199
-
- HY-P1514
-
- HY-P1537
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
Endocrinology
|
|
Pancreatic Polypeptide, bovine, a 36-amino acid, straight chain polypeptide derived primarily from the pancreas, inhibits secretin- and cholecystokinin-stimulated pancreatic secretion; Pancreatic Polypeptide, bovine acts as an agonist of NPY receptor, with high affinity at NPYR4.
|
- HY-P0198A
-
- HY-P0212
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
- HY-P0212A
-
|
|
GCGR
|
Metabolic Disease
|
|
Neuropeptide Y, porcine TFA, a peptide in porcine brain, is capable of inhibiting secretin-stimulated pancreatic secretion .
|
- HY-P1323
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) can increase blood pressure in anesthetized rats and increases food intake .
|
- HY-P1323A
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
[Leu31,Pro34]-Neuropeptide Y(human,rat) TFA is a specific neuropeptide Y Y1 receptor agonist. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA slao activates Y4, Y5. [Leu31,Pro34]-Neuropeptide Y(human,rat) TFA can increase blood pressure in anesthetized rats and increases food intake .
|
- HY-P0208
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
[Leu31,Pro34]- Neuropeptide Y (porcine), a Neuropeptide Y (NPY) analog, is a selective NPY Y1 receptor agonist. [Leu31,Pro34]- Neuropeptide Y (porcine) exhibits anxiolytic effects .
|
- HY-P3877
-
- HY-P4060
-
- HY-P4973
-
|
|
Peptides
|
Others
|
|
Calcitonin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5203
-
|
EntK1
|
Bacterial
|
Infection
|
|
Enterocin K1 (EntK1) is a bacteriocin. Enterocin K1 is a ribosomal synthetic peptide. Enterocin K1 specifically targets Enterococcus faecalis via the Eep protein on the bacterial membrane. Enterocin K1 displays a potent antibacterial activity against VRE. Enterocin K1 can be used for related studies of VRE infections .
|
- HY-P5204
-
|
K1-EJ hybrid
|
Bacterial
|
Infection
|
|
Enterocin Hybrid 1 is a antibacterial agent, a antibacterial composition. Enterocin Hybrid 1 inhibits Vancomycin (HY-B0671)-resistant E. faecium, Staphylococcus haemoliticus .
|
- HY-P5662
-
|
|
Bacterial
|
Infection
|
|
Brevinin-2EC is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P3877A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
(Leu31,Pro34)-Peptide YY (human) (TFA) is the TFA form of (Leu31,Pro34)-Peptide YY (human) (HY-P3877). (Leu31,Pro34)-Peptide YY (human) (TFA) is a Peptide YY (HY-P1514) derivative and is a potent and selective Y1 agonist with a KD of 1.0 nM .
|
- HY-P0090A
-
|
Salmon calcitonin acetate
|
CGRP Receptor
|
Cancer
|
|
Calcitonin (salmon) (acetate) is a dual-action amylin and calcitonin receptor agonist, can stimulate bone formation and inhibit bone resorption .The acetate form can affect the absorption and efficacy of hormones .
|
- HY-P10265
-
|
|
Melanocortin Receptor
|
Others
|
|
Melanostatin, frog is an inhibitor for α-melanocyte-stimulating hormone (α-MSH) release, with an IC50 of 60 nM .
|
- HY-P10291
-
- HY-P10545
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
[D-His26]-Neuropeptide Y, human, rat is a synthetic variant of neuropeptide Y (NPY). [D-His26]-Neuropeptide Y, human, rat acts as a Y1R agonist that can prevent the development of anxiety, social impairment, and depressive symptoms, and has the potential to be used as an early intervention treatment for post-traumatic stress reactions .
|
- HY-P10517
-
|
SFT
|
HIV
|
Infection
|
|
Sifuvirtide (SFT) is a potent HIV fusion inhibitor. Sifuvirtide inhibits HIV-1 mediated cell fusion in a dose-dependent manner and is highly potent against infection by primary and laboratory-adapted HIV-1 isolates of multiple genotypes. Sifuvirtide can be used in the research of anti-HIV drugs .
|
- HY-P4060A
-
- HY-P0198B
-
- HY-P5277
-
|
|
DAPK
|
Neurological Disease
|
|
TAT-GluN2BCTM is a membrane-permeable DAPK1-targeting peptide. TAT-GluN2BCTM targets active DAPK1 to lysosomes for degradation. TAT-GluN2BCTM protects neurons from oxidative stress and NMDAR-mediated excitotoxicity by knocking down DAPK1. TAT-GluN2BCTM can be used in the study of neuroprotection .
|
- HY-P5114
-
|
|
Calcium Channel
|
Others
|
|
Maurocalcine is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P5498
-
|
|
HIV
|
Others
|
|
N36 peptide is a biological active peptide. (HIV-1 gp41 fusion peptide)
|
- HY-P3037
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Imperatoxin A, a peptide toxin derived from the venom of the African scorpion Pandinus imperator, activator of Ca 2+-release channels/ryanodine receptors (RyRs) enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P5319
-
|
|
Peptides
Calcium Channel
|
Others
|
|
MCaE12A is a high-affinity modulator of RyR2 and increases RyR2 sensitivity to cytoplasmic calcium concentrations promoting channel opening. MCaE12A acts as an important tool for RyR2 structure-to-function studies as well as for manipulating Ca2+ homeostasis and dynamic of cardiac cell .
|
- HY-P3037A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Imperatoxin A TFA is a peptide toxin derived from the venom of the African scorpion Pandinus imperator. Imperatoxin A TFA is a Ca 2+-release channels/ryanodine receptors (RyRs) activator. Imperatoxin A TFA enhances the influx of Ca 2+ from the sarcoplasmatic reticulum into the cell .
|
- HY-P5114A
-
|
|
Calcium Channel
|
Others
|
|
Maurocalcine TFA is an agonist of ryanodine receptor (RyR) channel types 1, 2 and 3 with cellular permeability. Maurocalcine TFA induces [ 3H]ryanodine binding on RyR1 with an EC50 value of 2558 nM. Maurocalcine TFA exhibits a apparent affinity of 14 nM for RyR2. Maurocalcine TFA can be applied to in vivo cell tracking or other cell imaging techniques .
|
- HY-P0090S
-
|
Salmon calcitonin-13C6,15N4 TFA
|
CGRP Receptor
|
Metabolic Disease
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
- HY-P1477
-
- HY-P1477A
-
- HY-P2847
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, mouse is a potent and selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor with Ki values of 0.66 nM and ﹥100 nM for CRFR2 and CRFR1, respectively. Urocortin II, mouse activates CRF2 receptors in a cAMP/PKA- and Ca 2+/CaMKII-dependent manner.Urocortin II, mouse is expressed in discrete areas of the central nervous system, and activates central neurons involved in the processing of visceral sensory information, and in modulating autonomic outflow .
|
- HY-P3365
-
|
|
Bacterial
|
Inflammation/Immunology
Cancer
|
|
Cecropin D is an antimicrobial peptide with a MIC of 4.55 μg/mL. Cecropin D is effective against both Gram-negative and Gram-positive bacteria. Cecropin D has antiviral, antifungal, antitumor, and immunomodulatory .
|
- HY-P4765
-
|
|
Peptides
|
Others
|
|
Neuropeptide Y-Lys(biotinyl) (free acid) (human, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5363
-
|
Prostatic Acid Phosphatase(248-286)
|
HIV
|
Others
|
|
PAP 248–286 is a biological active peptide. (Prostatic Acid Phosphatase (248-286), PAP (248-286) peptide is a semen-derived enhancer of viral infection (SEVI) factor found in semen. This peptide greatly increases HIV infection through enhanced virion attachment to target cells.)
|
- HY-103545
-
|
Gastric inhibitory peptide (1-39) (porcine)
|
Peptides
|
Metabolic Disease
|
|
GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca 2+ concentration ([Ca 2+]i), and capable of enhancing exocytosis .
|
- HY-P5810
-
|
CcoTx2; β-TRTX-cm1b
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-2 (CcoTx2) is a voltage-gated sodium channel blocker with IC50s of 8 nM and 88 nM against Nav1.2/β1 and Nav1.3/β1, respectively .
|
- HY-P5811
-
|
CcoTx1; β-TRTX-cm1a
|
Sodium Channel
|
Neurological Disease
|
|
Ceratotoxin-1 (CcoTx1), a peptide toxin, is an voltage-gated sodium channel subtypes inhibitor. Ceratotoxin-1 inhibits Nav1.1/β1, Nav1.2/β1, Nav1.4/β1, and Nav1.5/β1 with IC50 of 523 nM, 3 nM, 888 nM, and 323 nM, respectively. Ceratotoxin-1 also inhibits Nav1.8/β1 .
|
- HY-P5649
-
|
|
Bacterial
|
Infection
|
|
PhD3 is an antimicrobial peptide derived from monkey white blood cells. PhD3 has activity against bacteria and fungus Candida albicans .
|
- HY-P5914
-
|
WaTx
|
TRP Channel
|
Neurological Disease
|
|
Wasabi Receptor Toxin is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
- HY-P5813
-
|
β-TRTX-cd1a; β-Theraphotoxin-cd1a
|
Peptides
|
Neurological Disease
|
|
Cd1a is a β-toxin derived from the African spider Ceratogyrus darlingi. Cd1a can regulate calcium ion channels. Cd1a inhibits human calcium ion channels (Cav2.2)(IC502.6 μM) and mouse sodium ion channels (Nav1.7). Cd1a can be used in the development of peripheral pain treatment drugs .
|
- HY-P10141
-
|
|
JNK
|
Cancer
|
|
JNK-IN-15, Cell-Permeable, Negative Control is a negative control of JNK-IN-15, Cell-Permeable (HY-P10140). JNK-IN-15, Cell-Permeable is an inhibitor of JNK .
|
- HY-P10140
-
|
|
JNK
|
Cancer
|
|
JNK-IN-15, Cell-Permeable (JNK inhibitor III) is an inhibitor of JNK. JNK-IN-15, Cell-Permeable can used in study age-related neurodegenerative diseasev .
|
- HY-P5914A
-
|
WaTx TFA
|
TRP Channel
|
Neurological Disease
|
|
Wasabi Receptor Toxin TFA (WaTx TFA) is the TFA salt form of Wasabi Receptor Toxin (HY-P5914). Wasabi Receptor Toxin TFA is a cell-penetrating scorpion toxin. Wasabi Receptor Toxin TFA is the activator for TRPA1 ion channel with EC50 in nanomolar level, and prolongs the channel open time, but reduces Ca 2+ permeability. Wasabi Receptor Toxin TFA causes thermal hypersensitivity and mechanical allodynia in rats, without triggering neurogenic inflammation .
|
- HY-P1295
-
|
Urocortin (human); Human urocortin; Human urocortin 1; Human urocortin I
|
CRFR
|
Neurological Disease
Endocrinology
|
|
Urocortin, human, a 40-aa neuropeptide, acts as a selective agonist of endogenous CRF2 receptor, with Kis of 0.4, 0.3, and 0.5 nM for hCRF1, rCRF2α and mCRF2β, respectively.
|
- HY-P1298
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine is effective at releasing ACTH from rat pituitary cells. Sauvagine possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
- HY-P1220
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin-IV is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P1220A
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin-IV TFA is a potent and selective sodium channel blocker, inhibits neuronal Nav1.7, Nav1.2, Nav1.3 and Nav1.4 with IC50s of 26, 150, 338 and 400 nM, respectively. Huwentoxin-IV TFA preferentially blocks peripheral nerve subtype Nav1.7 by binding neurotoxin receptor site 4. Huwentoxin-IV TFA has analgesic effects on animal models of inflammatory and neuropathic pain .
|
- HY-P1440A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BeKm-1 TFA is a potent and selective KV11.1 (hERG) channel blocker. BeKm-1 TFA is selective for KV11.1 over a panel of 14 other potassium channels. BeKm-1 TFA dose-dependently prolongs QTc interval in isolated rabbit heart.
|
- HY-P1440
-
- HY-P1681
-
- HY-P5788
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Hemitoxin, a scorpion-venom peptide, is a K + channel blocker. Hemitoxin blocks rat Kv1.1, Kv1.2 and Kv1.3 channels expressed in Xenopus oocytes with IC50 values of 13 nM, 16 nM and 2 nM, respectively .
|
- HY-P5790
-
|
|
Sodium Channel
|
Neurological Disease
|
|
μ-TRTX-Hd1a, a spider venom, is a selective NaV 1.7 inhibitor. μ-TRTX-Hd1a is a gating modifier that inhibits human NaV 1.7 by interacting with the S3b-S4 paddle motif in channel domain II .
|
- HY-P5793
-
- HY-P5943
-
- HY-P5179
-
|
HWTX-I
|
Calcium Channel
Sodium Channel
|
Neurological Disease
|
|
Huwentoxin I (HWTX-I) is a peptide toxin that inhibits voltage-gated sodium channels and N-type calcium channels. Huwentoxin I inhibits sodium channels in rat hippocampus and cockroach dorsal unpaired median (DUM) neurons with IC50 values of 66.1 and 4.80 nM, respectively .
|
- HY-P10116
-
|
APTscr-9R
|
Peptides
|
Others
|
|
APTSTAT3-9R, scrambled (APTscr-9R) is a control peptide that forms a structure similar to that of APTSTAT3-9R but possesses a scrambled sequence in the target-binding region .
|
- HY-P1372
-
|
|
PKC
|
Others
|
|
PKC ζ pseudosubstrate, a PKC ζ inhibitor peptide, can be attached to cell permeabilization vector peptide .
|
- HY-P0203B
-
- HY-P10716
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin-P5 is a selective agonist that targets the GLP-1R. Exendin-P5 promotes rapid activation of G proteins by transient interactions with the transmembrane domain of GLP-1R, enhancing its potency in G protein-mediated signaling and accelerating cAMP production. This mechanism suggests the potential application of Exendin-P5 in the study of metabolic diseases .
|
- HY-P1533
-
- HY-P1533A
-
- HY-P1298A
-
|
|
CRFR
|
Cardiovascular Disease
Neurological Disease
Endocrinology
|
|
Sauvagine TFA, a 40-amino-acid neuropeptide from the skin of the frog, is a mammalian CRF agonist. Sauvagine TFA is effective at releasing ACTH from rat pituitary cells. Sauvagine TFA possesses a number of pharmacological actions on diuresis, the cardiovascular system and endocrine glands .
|
- HY-P1282
-
- HY-P3503
-
|
BMN 111
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) is a modified recombinant CNP (C-type natriuretic peptide) analogue, binds to NPR-B (natriuretic peptide receptor type B) and reduces the activity of FGFR3 (fibroblast growth factor receptor 3). Vosoritide can be used in achondroplasia and dwarfism research .
|
- HY-P5080
-
|
|
Peptides
|
Others
|
|
Big Endothelin-2 (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3503A
-
|
BMN 111 acetate
|
FGFR
|
Others
|
|
Vosoritide (BMN 111) acetate is a natriuretic peptide receptor 2 (NPR2) agonist that acts on the proliferation and differentiation of chondrocytes to promote bone growth .
|
- HY-P5127
-
- HY-P5868
-
|
|
Sodium Channel
|
Neurological Disease
|
|
mHuwentoxin-IV is a naturally modified Huwentoxin-IV (HY-P1220). mHuwentoxin-IV inhibits tetrodotoxin-sensitive (TTX-S) voltage-gated sodium channels of dorsal root ganglion neurons with an IC50 of 54.16 nM. mHuwentoxin-IV inhibition of tetrodotoxin-sensitive sodium channels is not reversed by strong depolarization voltages .
|
- HY-P5870
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
KTX-Sp2 is a potassium channel toxin. KTX-Sp2 effectively blocks three types of exogenous voltage-gated potassium channels: Kv1.1, Kv1.2 and Kv1.3. Ktx-Sp2 inhibits endogenous Kv1.3 and suppresses Ca 2+ signaling in Jurkat T cells. Ktx-Sp2 inhibits IL-2 secretion from activated Jurkat T cells .
|
- HY-P5900
-
|
m3-HwTx-IV
|
Sodium Channel
|
Neurological Disease
|
|
m3-Huwentoxin IV (m3-HwTx-IV) is a potent NaV inhibitor with IC50s of 3.3, 6.8, 7.2, 8.4, 11.9 and 369 nM against hNaV1.7, hNaV1.6, hNaV1.3, hNaV1.1, hNaV1.2 and hNaV1.4, respectively in QPatch assay. m3-Huwentoxin IV dose-dependently suppresses spontaneous pain induced by the NaV1.7 activator OD1 in a rodent pain model .
|
- HY-P1434
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
[Pro3]-GIP (mouse) is a GIP receptor antagonist (IC50: 2.6 μM). [Pro3]-GIP (mouse) improves glucose tolerance and insulin sensitivity in ob/ob mice. [Pro3]-GIP (mouse) can be used for research of type 2 diabetes .
|
- HY-P5944
-
|
|
Peptides
|
Others
|
|
Deamino-pterinotoxin-1 is a peptide toxin synthesized from the deamination of pterinotoxin-1 (HY-5943) .
|
- HY-P5180
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-V is a peptide that inhibits potassium currents in Xenopus laevis oocytes with an IC50 value of 604.2 nM. Jingzhaotoxin-V also inhibits tetrodotoxin-resistant and tetrodotoxin-sensitive sodium currents in rat dorsal root ganglion neurons with IC50 values of 27.6 and 30.2 nM, respectively .
|
- HY-P5631
-
|
|
Bacterial
|
Infection
|
|
Rabbit neutrophil peptide 3b is an antimicrobial peptide derived from rabbit peritoneal neutrophils .
|
- HY-P5632
-
|
|
Bacterial
|
Infection
|
|
Bovine tracheal antimicrobial peptide is a kind of comes from the tracheal mucosa of antimicrobial peptides. Bovine tracheal antimicrobial peptide has activity against E.coli D31, K.pneumoniae 13883, S.aureus 25923, P.aeruginosa 27853 and C.albicans 14053, MIC value 12-25, 12-25, 25-50, 25-50, 6-12 μg/ml, respectively .
|
- HY-P5916
-
|
κ-Theraphotoxin-Gr4a; Kappa-TRTX-Gr4a; Voltage sensor toxin 3; Peptide F
|
Peptides
Potassium Channel
|
Neurological Disease
|
|
VSTx-3 is a KV channel blocker. VSTx-3 is demonstrated to be a potent, TTX-sensitive sodium channel blocker and especially, a potent blocker of NaV1.8 channels (IC50 0.19 μM for hNaV1.3, 0.43 μM for hNaV1.7 and 0.77 μM for hNaV1.8 channels).
|
- HY-103303
-
|
|
Peptides
|
Metabolic Disease
|
|
CRSP-1 is short for calcitonin receptor-stimulating peptide-1. CRSP-1 inhibits osteoclast formation by inhibiting the formation and activity of multinucleated osteoclast .
|
- HY-P10337
-
|
|
GCGR
GLP Receptor
|
Metabolic Disease
Endocrinology
|
|
OXM-7 is a dual agonist of GLP-1R (EC50=0.024 nM) and GCGR (EC50=0.082 nM). OXM-7 can enhance glucose-stimulated insulin secretion and hepatic glucose output. OXM-7 lowers blood glucose levels. OXM-7 improves lipid metabolism .
|
- HY-P10735
-
|
Gastric inhibitory polypeptide(mouse); GIP(1-42) (mouse)
|
Insulin Receptor
|
Endocrinology
|
|
GIP (mouse) is a gastrointestinal hormone that is expressed in and secreted from the pancreatic islets and promotes insulin secretion .
|
- HY-P0089
-
|
Growth Hormone Releasing Factor human; Somatorelin (1-44) amide (human)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor (Growth Hormone Releasing Factor human) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
- HY-P1280
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P0089A
-
|
Growth Hormone Releasing Factor human TFA; Somatorelin (1-44) amide (human) (TFA)
|
GHSR
|
Endocrinology
|
|
Human growth hormone-releasing factor TFA (Growth Hormone Releasing Factor human TFA) is a hypothalamic polypeptide and stimulates GH production and release by binding to the GHRH Receptor (GHRHR) on cells in the anterior pituitary .
|
- HY-P1281
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Kaliotoxin is a peptidyl inhibitor of neuronal BK-Type. Kaliotoxin can specific inhibit Kv channels and calcium-activated potassium channels. Kaliotoxin can be used for the research of the regulation of membrane potential and neuron excitability .
|
- HY-P1409
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 can be used to study T cell-mediated autoimmune diseases .
|
- HY-P1426
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 is specific blocker of Kv4 channel. AmmTX3 inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P5165
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Maurotoxin is a 34-residue and four disulde-bridged toxin that can be isolated from the chactoid scorpion (Scorpio maurus). Maurotoxin inhibits the Shaker potassium channels (ShB) K + current with an IC50 of 2 nM .
|
- HY-P1280A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Margatoxin TFA, an alpha-KTx scorpion toxin, is a high affinity inhibitor of Kv1.3 (Kd=11.7 pM). Margatoxin TFA inhibits the Kv1.2 (Kd=6.4 pM) and Kv1.1 (Kd=4.2 nM). Margatoxin TFA, a 39 amino-acid-long peptide, is isolated from the venom of the scorpion Centruroides margaritatus and widely used in ion channel research .
|
- HY-P5853
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
Aam-KTX is a Kv channel inhibitor with IC50 values of 1.1 nM and >750 nM for Kv1.3 and Kv1.1, respectively. Aam-KTX is a toxic peptide obtained from the venom of the scorpion Mesobuthus eupeus. Aam-KTX has potential in autoimmune diseases research .
|
- HY-P1108
-
|
|
CFTR
|
Others
|
|
Astressin 2B is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B antagonizes CRF2-mediated inhibition of gastric emptying .
|
- HY-P5931
-
|
Potassium channel toxin alpha-KTx 6.13; SPX; α-KTx6.13
|
Potassium Channel
|
Inflammation/Immunology
Cancer
|
|
Spinoxin isolated from the venom of scorpion Heterometrus spinifer, is a 34-residue peptide neurotoxin cross-linked by four disulfide bridges. Spinoxin is a potent inhibitor of Kv1.3 potassium channel (IC50 = 63 nM), considering to be valid molecular targets in the diagnostics and therapy of various autoimmune disorders and cancers .
|
- HY-P5182
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
HsTX1, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1, an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P5921
-
|
TsTx-Kα
|
Peptides
|
Neurological Disease
|
|
Tityustoxin-Kα (TsTx-Kα) is an inhibitor of potassium voltage-gated channels. Tityustoxin-Kα shows a dose-dependent block of the sustained outward current in cultured hippocampal neurons .
|
- HY-P1108A
-
|
|
CFTR
|
Others
|
|
Astressin 2B TFA is a potent and selective corticotropin-releasing factor receptor 2 (CRF2) antagonist, with the IC50 values of 1.3 nM and > 500 nM for CRF2 and CRF1, respectively. Astressin 2B TFA antagonizes CRF2-mediated inhibition of gastric emptying .
|
- HY-P5182A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
HsTX1 (TFA) toxin, from the scorpion Heterometrus spinnifer, is a 34-residue, C-terminally amidated peptide cross-linked by four disulfide bridges. HsTX1 (TFA) is an the inhibitor of potassium channel, with IC50 for Kv1.3 of 12 pM and inhibits TEM cell activation and attenuates inflammation in autoimmunity .
|
- HY-P10721
-
|
|
Antibiotic
Bacterial
|
Infection
|
Plectasin is a peptide antibiotic derived from saprophytic fungi. Plectasin can kill pneumococcus in vitro. Plectasin can alleviate experimental peritonitis and pneumonia caused by pneumococcus in mice .
|
- HY-P1409A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
ADWX 1 TFA is a new peptide inhibitor that is potent and selective for Kv1.3 with an IC50 value of 1.89 pM. ADWX 1 inhibits Kv1.3 channel activity specifically to inhibit both the initial calcium signaling and NF-κB activation. ADWX 1 TFA ameliorates the disease in rats of experimental autoimmune encephalomyelitis (EAE) models. ADWX 1 TFA can be used to study T cell-mediated autoimmune diseases .
|
- HY-P1805
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin Binding Peptide 1 is a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide), which strongly inhibits IP3-induced Ca 2+ release .
|
- HY-P4157
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI is a senolytic peptide that induces apoptosis of senescent cells .
|
- HY-P4157A
-
|
|
MDM-2/p53
Apoptosis
|
Metabolic Disease
|
|
FOXO4-DRI acetate is a cell-permeable peptide antagonist that blocks the interaction of FOXO4 and p53. FOXO4-DRI acetate is a senolytic peptide that induces apoptosis of senescent cells .
|
- HY-P4127
-
|
|
Peptides
|
Neurological Disease
|
|
M65 is a deleted peptide of maxadilan (61 a.a.) with deletion of the residues between positions 24 and 42 and is a specific antagonist of PACAP type 1 receptor that inhibits ANP secretion and can be used for relevant researches .
|
- HY-P1330
-
|
|
P2X Receptor
|
Inflammation/Immunology
|
|
Purotoxin 1 is a P2X3 receptor inhibitor. Purotoxin 1 shows antinociceptive properties in animal models of inflammatory pain. Purotoxin 1 can be isolated from the venom of the wolf spider Geolycosa sp .
|
- HY-P5710
-
|
|
Bacterial
|
Infection
|
|
LCI peptide is an antimicrobial peptide with antibacterial activity. LCI peptide is active against plant pathogens, Xanthomonas and Pseudomonas, including E. coli, Gentamicin-resistant MRSA and Xoo .
|
- HY-P5917
-
|
Vaejovis mexicanus peptide 24
|
Potassium Channel
|
Others
|
|
Vm24-toxin is a toxin peptide that can be isolated from the Mexican scorpion Vaejovis mexicanus smithy. Vm24-toxin is an inhibitor of Kv1.3 potassium channel .
|
- HY-P1426A
-
|
|
Potassium Channel
|
Inflammation/Immunology
|
|
AmmTX3 TFA is a peptide toxin that can be isolated from the venom of the scorpion Androctonus mauretanicus. AmmTX3 TFA is specific blocker of Kv4 channel. AmmTX3 TFA inhibits the A-type K + current (Ki: 131 nM) .
|
- HY-P10078
-
- HY-P4127A
-
- HY-P2469
-
|
BNP-45, mouse
|
Peptides
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide-45, mouse (BNP-45, mouse) is a circulating form of mouse brain natriuretic peptide isolated from mouse heart with potent hypotensive and natriuretic potency .
|
- HY-P1727
-
|
|
YAP
|
Cancer
|
|
Super-TDU is a specific YAP antagonist targeting YAP-TEADs interaction. Super-TDU suppresses tumor growth in gastric cancer mouse model .
|
- HY-P5818
-
- HY-P5920
-
- HY-P5806
-
|
ErgTx1
|
Peptides
|
Neurological Disease
|
|
Ergtoxin-1 is a potassium channel blocker.
Ergtoxin-1 is isolated from the venom of the Mexican scorpion
Centruroides noxius. Ergtoxin 1 can block
ERG-K + channels in nerve, heart and endocrine cells .
|
- HY-P5156
-
|
|
Potassium Channel
|
Neurological Disease
|
|
BDS-I known as blood depressing substance, is a marine toxin which can be extracted from Anemonia sulcata. BDS-I is a specific inhibitor of Potassium Channel, targeting to Kv3.4. BDS-I inhibits Aβ1-42-induced enhancement of KV3.4 activity, caspase-3 activation, and abnormal nuclear morphology of NGF-differentiated PC-12 cells. BDS-I reverts the Aβ peptide-induced cell death .
|
- HY-P5824
-
- HY-P1534
-
- HY-P1079
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin TK, a peptidyl toxin of the venom of Agelenopsis aperta, is a potent and selective P/Q type Ca 2+ channel blocker. ω-Agatoxin TK inhibits the high K + depolarisation-induced rise in internal Ca 2+ in cerebral isolated nerve endings with an IC50 of of 60 nM. ω-Agatoxin TK has no effect on L-type, N-type, or T-type calcium channels .
|
- HY-P4853
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Adrenomedullin (rat) is an effective vasodilator peptide. Adrenomedullin is actively secreted by endothelial cells (EC) and vascular smooth muscle cells (VSMC) .
|
- HY-P1604
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
ATX-II is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II causes delayed inactivation of the Na +
|
- HY-P1604A
-
|
|
Sodium Channel
|
Inflammation/Immunology
|
|
ATX-II TFA is a specific Na + channel Modulator toxin that can be isolated from the venom of sea anemone (Anemonia sulcata). ATX-II TFA causes delayed inactivation of the Na +
|
- HY-P4898
-
|
|
Sodium Channel
|
Cardiovascular Disease
|
|
Anthopleurin-A is a soidum channel toxin. Anthopleurin-A is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A can be isolated from the sea anemone .
|
- HY-P4898A
-
|
|
Sodium Channel
|
Cardiovascular Disease
|
|
Anthopleurin-A TFA is a soidum channel toxin. Anthopleurin-A TFA is selective for cardiac channels and has cardiotonic effect. Anthopleurin-A TFA can be isolated from the sea anemone .
|
- HY-P10720
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse is an activator of particulate guanylate cyclase B (pGC-B), which is highly expressed in endothelial cells, kidneys, and the heart. C-Type Natriuretic Peptide (1-53), Porcine, Rat, mouse can mediate a potent anti-fibrotic effect in human cardiac and renal fibroblasts by generating the second messenger cGMP .
|
- HY-P1815
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
- HY-P1815A
-
|
|
Angiotensin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
C-Type Natriuretic Peptide (1-53), human TFA is the 1-53 fragment of C-Type Natriuretic Peptide. C-Type Natriuretic Peptide TFA is natriuretic peptide family peptide that is involved in the maintenance of electrolyte-fluid balance and vascular tone .
|
- HY-P4766
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Adrenomedullin (porcine) is a peptide that regulates vasodilation. Adrenomedullin (porcine) induces endothelium-dependent relaxation in rat aorta with IC50 value of 2.4 nM. Adrenomedullin (porcine) induces endothelium-independent relaxation of porcine coronary arteries with an IC50 of 27.6 nM .
|
- HY-P3089
-
|
|
Potassium Channel
|
Others
|
|
Dendrotoxin K is a Kv1.1 channel blocker. Dendrotoxin K determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P3561
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P3089A
-
|
|
Potassium Channel
|
Others
|
|
Dendrotoxin K TFA is a Kv1.1 channel blocker. Dendrotoxin K TFA determines glutamate release in CA3 neurons in a time-dependent manner through the control of the presynaptic spike waveform .
|
- HY-P5065
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (rat) is a 60 amino acid neuropeptide. Galanin-Like Peptide (rat) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
- HY-P3561A
-
|
|
Melanocortin Receptor
|
Neurological Disease
|
|
Agouti-related Protein (AGRP) (83-132) Amide (human) TFA is a fragment of agouti-related protein (AGRP) which is a protein found in abundance in the arcuate nucleus of the hypothalamus. AgRP primarily acts as an inverse agonist for the melanocortin-4 receptor (MC4R) to increase food intake .
|
- HY-P2291
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
- HY-P2291A
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Beta-defensin 103 isoform X1, pig TFA is an antimicrobial peptide found in different living organisms, involved in the first line of defense in their innate immune response against pathogens .
|
- HY-108719
-
- HY-106216
-
|
|
Elastase
|
Infection
Inflammation/Immunology
|
|
Tiprelestat is a potent human neutrophil elastase inhibitor. Tiprelestat has antimicrobial and anti-inflammatory activities. Tiprelestat can be used in the research of inflammation/immune disease .
|
- HY-P5796
-
|
|
Calcium Channel
|
Neurological Disease
|
|
FS-2 is a potent and specific L-type CaV channel inhibitor. FS-2 inhibits high K + or glucose induced L-type Ca 2+ influx in RIN beta cells .
|
- HY-P5835
-
|
|
Potassium Channel
|
Neurological Disease
|
|
δ-Dendrotoxin is a K + channel blocker that can be obtained from the venom of the black mamba snake. δ-Dendrotoxin can be used in the study of neurological diseases .
|
- HY-P3269
-
|
|
Calcium Channel
|
Others
|
|
Calciseptine, a natural?neurotoxin?isolated from the black mamba Dendroaspis p. polylepis venom. Calciseptine consists of 60 amino acids with four disulfide bonds. Calciseptine specifically blocks L-type?calcium channel[1].
|
- HY-P5459
-
|
|
Bacterial
Elastase
|
Infection
|
|
Elafin,also known as elafin-specific inhibitor (ESI) or skin anti-leucoprotease (SKALP), is a low molecular weight inhibitor of human neutrophil elastase (HNE) and proteinase 3 in lung. Elafin is antibiotic against Pseudomonas aeruginosa and Staphylococcus aureus .
|
- HY-P3065
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Calcicludine is a protein toxin from the venom of the green mamba Dendroaspis angusticeps that inhibits high-voltage-activated calcium channel, especially L-type calcium channel with the IC50 of 88 nM. Calcicludine has role in excitatory synaptic transmission .
|
- HY-P5081
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Endotrophin (Mus musculus) is a cleavage product of collagen 6 (Col6). Endotrophin upregulation of both profibrotic and proinflammatory genes .
|
- HY-P5152
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Scorpion toxin Tf2 is a β-scorpion toxin, which is firstly identified in the venom of the Brazilian scorpion Tityus fasciolatus. Scorpion toxin Tf2 is a Nav1.3 activator, which is a neuronal voltage-gated sodium (Nav) subtype implicated in epilepsy and nociception. Scorpion toxin Tf2 enhances hNav1.3 activation voltage and opens the channel at resting membrane potentials .
|
- HY-P1264
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs). α-Bungarotoxin, a selective α7 receptor blocker, blocks α7 currents with an IC50 of 1.6 nM and has no effects on α3β4 currents at concentrations up to 3 μM .
|
- HY-P1264F1
-
|
|
nAChR
|
Neurological Disease
|
|
Biotin-α-Bungarotoxin is the Biotin labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P1264F
-
|
|
nAChR
|
Neurological Disease
|
|
α-Bungarotoxin, FITC labeledis the FITC labelled α-Bungarotoxin (HY-P1264). α-Bungarotoxin is a competitive antagonist at nicotinic acetylcholine receptors (nAChRs) .
|
- HY-P4240
-
|
|
Peptides
|
Others
|
|
N2-L-Alanylasparagine is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5695
-
|
|
Bacterial
|
Infection
|
|
GP-2B is an antimicrobial peptide. GP-2B shows antibacterial activity against Gram-positive strain (MIC: 8-128 μg/mL for S. aureus and Enterococcus faecalis) .
|
- HY-P5359
-
- HY-P4427
-
|
|
Fluorescent Dye
|
Others
|
|
Z-VAN-AMC is a fluorogenic substrate. Z-VAN-AMC can be hydrolysed by a phytophagous mite of legumain-like activity .
|
- HY-P0078
-
TRAP-6
4 Publications Verification
PAR-1 agonist peptide; Thrombin Receptor Activator Peptide 6
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
TRAP-6 (PAR-1 agonist peptide), a peptide fragment, is a selective protease activating receptor 1 (PAR1) agonist. TRAP-6 activates human platelets via the thrombin receptor. TRAP-6 shows no activity at PAR4 .
|
- HY-P1740
-
|
|
Integrin
Apoptosis
Caspase
|
Inflammation/Immunology
|
|
RGD peptide (GRGDNP) is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) plays an important role in cell adhesion, migration, growth, and differentiation .
|
- HY-P1740A
-
|
|
Integrin
Apoptosis
|
Inflammation/Immunology
Cancer
|
|
RGD peptide (GRGDNP) TFA is an inhibitor of integrin-ligand interactions. RGD peptide (GRGDNP) TFA competitively inhibits α5β1 binding with extracellular matrice (ECM). RGD peptide (GRGDNP) TFA promotes apoptosis through activation of conformation changes that enhance pro-caspase-3 activation and autoprocessing. RGD peptide (GRGDNP) TFA plays an important role in cell adhesion, migration, growth, and differentiation .
|
- HY-P2518
-
|
|
Protease Activated Receptor (PAR)
|
Inflammation/Immunology
|
|
Protease-Activated Receptor-1, PAR-1 Agonist is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
- HY-P2518A
-
|
|
Protease Activated Receptor (PAR)
|
Cancer
|
|
Protease-Activated Receptor-1, PAR-1 Agonist TFA is a selective proteinase-activated receptor1 (PAR-1) agonist peptide. Protease-Activated Receptor-1, PAR-1 Agonist TFA corresponds to PAR1 tethered ligand and which can selectively mimic theactions of thrombin via this receptor .
|
- HY-P4279
-
- HY-P5060
-
|
|
Peptides
|
Others
|
|
PAR-1 (1-6) (mouse, rat) is a polypeptide fragment of protease-activated receptor 1 .
|
- HY-P10549
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
NGFFFamide is a muscle-active neuropeptide found in sea urchins. NGFFFamide regulates muscle activity by directly interacting with receptor proteins on muscle cells, or indirectly by stimulating nerves or other cell types to release muscle-active factors. NGFFFamide can be used to study muscle contraction and relaxation .
|
- HY-P10831
-
|
|
VEGFR
|
Cardiovascular Disease
Cancer
|
|
GNQWFI, an anti-Flt1 peptide, is a VEGFR1-specific antagonist. GNQWFI blocks the interaction of VEGFR1 with various VEGFR1 ligands, such as VEGFA, VEGFB, and placental growth factor (PIGF) and inhibits VEGF-induced endothelial cell migration and tube formation. GNQWFI is promising for research of anti-angiogenic therapeutics for the treatment of cancer, asthma, and other ocular diseases .
|
- HY-P2517
-
|
|
Peptides
|
Others
|
|
Scrambled TRAP Fragment is a scrambled sequence of TRAP Fragment. Scrambled TRAP Fragment with a random sequence of the amino acids that are the same as the active fragment. Scrambled TRAP Fragment usually used as a negative control.
|
- HY-P5001
-
- HY-P5357
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
SFNGGP-NH2 is a biological active peptide. (PAR-3 is a high-affinity thrombin receptor. PAR-3 mRNA is expressed in the cutaneous mast cells of humans. Protease-Activated Receptors (PARs) have been studied for their roles in itch and their itch-associated response through histamine-dependent/independent pathways have been reported. PAR-3 has been shown not to induce itching alone but possibly in conjunction with PAR-4. Co-expression of PAR-3 and PAR-4 enhances thrombin action suggesting that PAR-3 alone does not mediate transmembrane signaling but instead functions as a cofactor to activate PAR-4.)
|
- HY-P5358
-
|
|
Protease Activated Receptor (PAR)
|
Others
|
|
YFLLRNP is a biological active peptide. (a partial agonist of PAR-1. YFLLRNP selectively active G12/13 signaling pathway without activating Gq or Gi pathways at low concentrations. YFLLRNP (60 μM))
|
- HY-P5360
-
- HY-P4987
-
|
|
Protease Activated Receptor (PAR)
|
Cardiovascular Disease
|
|
TRAP-7 is a thrombin receptor (PAR) activating peptide. TRAP-7 stimulates total inositol phosphate (IP) accumulation and phosphorylation of a specific endogenous substrate for activated PKC. TRAP-7 can be used in cardiovascular disease research .
|
- HY-P10293
-
|
|
Thrombin
Peptides
|
Others
|
|
NQEQVSP, a fibrin-binding protein-derived peptide (FBP), is a factor XIIIa substrate. NQEQVSP can be recognized by factor XIII and is enzymatically conjugated into fibrin during polymerization .
|
- HY-P10366
-
|
|
Peptides
|
Infection
|
|
WEYIPNV is a ligand for SurA, specifically binding to the P1 domain of SurA (Kd: 1-14 μM). The binding of WEYIPNV promotes the release of the P1 domain from the core domain .
|
- HY-P3119
-
|
Desotamide A
|
Bacterial
|
Infection
|
|
Desotamide is a cyclic hexapeptide antibiotic originally isolated from Streptomyces. It is active against S. aureus, S. pneumoniae, and methicillin-resistant S. epidermidis (MRSE; MICs=16, 12.5, and 32 μg/mL, respectively).
|
- HY-P10541
-
|
|
Peptides
|
Others
|
|
HSP70/DnaK substrate peptide is a short peptide that the HSP70/DnaK molecular chaperone can bind and act on. HSP70/DnaK substrate peptide can be used to study the mechanism of action of HSP70/DnaK in molecular chaperone function .
|
- HY-P10643
-
|
|
Peptides
|
Infection
|
|
Skeletal muscle-targeted peptide MSP is a 7-amino-acid (ASSLNIA) muscle-targeting peptide (MTP). Skeletal muscle-targeted peptide MSP can target the virus through a different binding ligand to the muscle. Skeletal muscle-targeted peptide MSP can be used for the research of diseases of the heart and skeletal muscles .
|
- HY-P0272
-
|
|
HIV
|
Infection
|
|
Peptide T is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
- HY-P1452A
-
|
|
Bacterial
|
Infection
|
|
RNAIII-inhibiting peptide(TFA) is a potent inhibitor of Staphylococcus aureus, effective in the diseases such as cellulitis, keratitis, septic arthritis, osteomylitis and mastitis.
|
- HY-P1489
-
|
|
Peptides
|
Inflammation/Immunology
|
|
OVA Peptide(257-264) is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
|
- HY-P0272A
-
|
|
HIV
|
Infection
|
|
Peptide T (TFA) is an octapeptide from the V2 region of HIV-1 gp120. Peptide T is a ligand for the CD4 receptor and prevents binding of HIV to the CD4 receptor.
|
- HY-P1489A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
OVA Peptide(257-264) TFA is a class I (Kb)-restricted peptide epitope of OVA, an octameric peptide can be from ovalbumin presented by the class I MHC molecule, H-2Kb.
|
- HY-P1707A
-
|
|
Tau Protein
|
Neurological Disease
|
|
Tau protein (592-597), human TFA is a peptide fragment of human Tau protein. The dysfunction of Tau protein is involved in neurodegeneration and dementia .
|
- HY-P2319
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
- HY-P2319A
-
|
|
p38 MAPK
JNK
|
Inflammation/Immunology
|
|
OVA-E1 peptide TFA, is an antagonist variant of SIINFEKL [OVA (257-264). OVA-E1 peptide, activates the p38 and JNK cascades similarly in mutant and wild-type thymocytes .
|
- HY-P4778
-
|
|
Peptides
|
Others
|
|
Neurotensin (1-8) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4733
-
|
|
Peptides
|
Others
|
|
Lactoferrin (322-329) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5400
-
|
|
Peptides
|
Others
|
|
OVA (257-264), scrambled is a biological active peptide. (Out-of-order control peptide of HY-P1489)
|
- HY-P5406
-
|
SAINFEKL, OVA (257-264) Variant
|
Peptides
|
Others
|
|
OVA-A2 Peptide (SAINFEKL, OVA (257-264) Variant) is a biological active peptide. (A2 peptide (SAINFEKL) is a (OVA) peptide (257-264) variant with antigenic effect.)
|
- HY-P10197
-
|
|
Peptides
|
Others
|
|
DABCYL-VNLDAE-EDANS is a substrate of b-secretase. DABCYL-VNLDAE-EDANS can be used in BACE enzyme assays .
|
- HY-P1716
-
|
|
PKC
|
Neurological Disease
|
|
Neuropeptide DF2 is a DRNFLRFamide neuropeptide orignally isolated from crayfish. which enhances transmitter release and stimulates the amplitude of excitatory post-synaptic potentials (EPSP) through the calcium/calmodulin-dependent protein kinase .
|
- HY-P10390
-
|
|
Parasite
|
Infection
|
|
Insecticidal agent 11 (compound Q6) is a potent insect growth regulator (IGR)-based insecticide. Insecticidal agent 11 shows high insecticidal activity against Diploptera punctata by inhibiting juvenile hormone (JH) biosynthesis. Insecticidal agent 11 also exhibits insecticidal activity against Plutella xylostella .
|
- HY-P10582A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
SIYNFEKL TFA is a variant of major MHC class I-restricted epitope SIINFEKL. SIYNFEKL TFA is an antigenic peptide, that can stimulate specific T cells in experimental settings to study the competitive interaction between T cell. SIYNFEKL TFA exhibits low affinity for the OT-I T cell receptor (TCR), and can be used for detection of CD8+ T cells .
|
- HY-P0323
-
|
|
Arenavirus
|
Infection
|
|
GP(33-41), a 9-aa-long peptide, is the optimal sequence of the GP1 epitope of lymphocytic choriomeningitis virus, and can upregulate H-2D b molecules at the RMA-S (Db Kb) cell surface with a SC50 of 344 nM .
|
- HY-P0303
-
|
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
|
Crustacean cardioactive peptide，free acid is a highly conserved, amidated cyclic nonapeptide, first isolated from the pericardial organs of the shore crab Carcinus maenas, where it has a role in regulating heartbeat; Crustacean cardioactive peptide，free acid also modulates the neuronal activity in other arthropods.
|
- HY-P0302
-
|
|
Peptides
|
Infection
|
|
HEX3 is a fragment of the adenoviral hexon. Hexon is the major capsid protein of adenovirion and is comprised of three identical polypeptide chains.
|
- HY-P1034
-
DAPTA
2 Publications Verification
D-Ala-peptide T-amide; Adaptavir
|
CCR
HIV
|
Infection
Endocrinology
|
|
DAPTA is a synthetic peptide, functions as a viral entry inhibitor by targeting selectively CCR5, and shows potent anti-HIV activities.
|
- HY-P1569
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41, the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P1571
-
|
NP 396
|
Arenavirus
|
Inflammation/Immunology
|
|
Nucleoprotein (396-404) is the 396 to 404 fragment of lymphocytic choriomeningitis virus (LCMV). Nucleoprotein (396-404) is the H-2D(b)-restricted immunodominant epitope and can be used as a molecular model of viral antigen .
|
- HY-P1585
-
|
Hgp100 (25-33)
|
Peptides
|
Inflammation/Immunology
|
|
Gp100 (25-33), human (Hgp100 (25-33)) is the amino acids 25-33 fragment of the human melanoma antigen. It is a 9-amino acid (AA) epitope restricted by H-2D b and recognized by the T cells .
|
- HY-P1757
-
|
|
HIV
|
Infection
|
|
HIV p17 Gag (77-85) is an HLA-A*0201(A2)-restricted CTL epitope, used in the research of anti-HIV .
|
- HY-P1780
-
|
|
CMV
|
Infection
|
|
CEF20 is an HLA-A*0201-restricted epitope from cytomegalovirus pp65 (495-503).
|
- HY-P1845
-
|
|
ERK
EGFR
Reactive Oxygen Species
Calcium Channel
|
Neurological Disease
|
|
PACAP-38 (31-38), human, mouse, rat is a PAC1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat elevates cytosolic Ca 2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat can be used for neurotrophic and neuroprotective research .
|
- HY-P1907
-
|
|
HPV
|
Cancer
|
|
Human Papillomavirus (HPV) E7 protein (49-57) is the H-2 d-restricted human papillomavirus (HPV) E749-57 epitope (short peptide spanning the 49th to 57th amino acid residues in the E7 protein) .
|
- HY-P1917
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Uty HY Peptide (246-254), derived from the ubiquitously transcribed tetratricopeptide repeat gene on the Y chromosome (UTY) protein as an H-Y epitope, H-YD b, is a male-specific transplantation antigen H-Y .
|
- HY-P1899
-
- HY-P1585A
-
|
Hgp100 (25-33) (TFA)
|
Peptides
|
Cancer
|
|
Gp100 (25-33), human TFA (Hgp100 (25-33) TFA) is the amino acids 25-33 fragment of the human melanoma antigen. It is a 9-amino acid (AA) epitope restricted by H-2D b and recognized by the T cells .
|
- HY-P1569A
-
|
|
Arenavirus
|
Inflammation/Immunology
|
|
LCMV gp33-41 (TFA), the carboxyl-extended 11-aa-long peptide, is an lymphocytic choriomeningitis virus sequence restricted by MHC class I H-2Db molecules and presented to cytotoxic T lymphocytes .
|
- HY-P1845A
-
|
|
ERK
EGFR
Reactive Oxygen Species
Calcium Channel
|
Neurological Disease
|
|
PACAP-38 (31-38), human, mouse, rat TFA is a PAC1 receptor activator and increases the α-secretase activity. PACAP-38 (31-38), human, mouse, rat TFA elevates cytosolic Ca 2+, increases proliferation and increases phosphorylation of extracellular regulates kinase (ERK) and the epidermal growth factor receptor (EGFR). PACAP-38 (31-38), human, mouse, rat TFA demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production. PACAP-38 (31-38), human, mouse, rat TFA can be used for neurotrophic and neuroprotective research .
|
- HY-P1571A
-
|
NP 396 TFA
|
Arenavirus
|
Inflammation/Immunology
|
|
Nucleoprotein (396-404) TFA is the 396 to 404 fragment of lymphocytic choriomeningitis virus (LCMV). Nucleoprotein (396-404) TFA is the H-2D(b)-restricted immunodominant epitope and can be used as a molecular model of viral antigen .
|
- HY-P1090
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin(rat) is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin(rat) is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin(rat) exerts antinociceptive action in inflammatory pain models .
|
- HY-P1090A
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin(rat) TFA is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin(rat) TFA is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin(rat) TFA exerts antinociceptive action in inflammatory pain models .
|
- HY-P1091
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin exerts antinociceptive action in inflammatory pain models .
|
- HY-P1091A
-
|
|
Cannabinoid Receptor
|
Neurological Disease
|
|
Hemopressin TFA is a nonapeptide derived from the α1-chain of hemoglobin, is originally isolated from rat brain homogenates. Hemopressin TFA is orally active, selective and inverse agonist of CB1 cannabinoid receptors. Hemopressin TFA exerts antinociceptive action in inflammatory pain models .
|
- HY-P2455
-
|
Listeriolysin O (91-99)
|
Bacterial
|
Inflammation/Immunology
|
|
LLO (91-99) (Listeriolysin O (91-99)), an exotoxin, is a class I MHC-restricted T-cell epitopes of listeriolysin (LLO). LLO (91-99) is an essential antigen for induction of T-cell mediated immunity in vivo .
|
- HY-P2506
-
|
Mgp100 (25-33)
|
Peptides
|
Cancer
|
|
Gp100 (25-33), mouse sequence is found in residues 25 to 33 of the mouse self/tumor antigen glycoprotein (mgp100). Mgp100 is an enzyme involved in pigment synthesis, and the epitope fragment is expressed in both normal melanocytes and melanoma cells .
|
- HY-P2531
-
|
|
Peptides
|
Others
|
|
OVA (329-337) is a 9-aa core epitope (329–337) located in the C-terminal end of the OVA peptide .
|
- HY-P3824
-
|
|
Peptides
|
Others
|
|
Red pigment-concentrating hormone is a chromatophorotropic hormone and is synthesized in the eyestalk. Red pigment-concentrating hormone may plays a role as a downstream hormone of 5-HT .
|
- HY-P3058
-
|
WT-1 A1
|
Peptides
|
Cancer
|
|
Ederimotide(WT-1 A1) can be used as a potential target for studying pancreatic cancer .
|
- HY-P4088
-
|
|
Peptides
|
Cancer
|
|
LyP-2 is a peptide that homes to tumor lymphatics. LyP2 homes to lymphatics of C8161 melanomas and cervical carcinomas and K14-HPV16 skin, but not to MDA-MB435 tumors, showing heterogeneity in the molecular markers of tumor cells and lymphatics .
|
- HY-P4763
-
|
|
Peptides
|
Others
|
|
Neuromedin U-8 (porcine) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5449
-
- HY-P5487
-
|
|
iGluR
|
Others
|
|
GluR23Y is a biological active peptide. (This GluR23Y peptide was used in ELISA cell-surface assay for the insulin-stimulated endocytosis of native AMPA receptors in cultured hippocampal neurons. GluR23Y prevented any insulin-induced reduction. The blockade of insulin action was observed when the GluR23Y peptide was delivered into neurons by fusing it to the membrane transduction domain of HIV-1.)
|
- HY-P5489
-
|
|
Phosphatase
|
Others
|
|
IGRP(206-214) is a biological active peptide. (This peptide corresponds to residues 206–214 of murine islet-specific glucose-6-phosphatase catalytic subunit–related protein (IGRP). This peptide is T cells specific for proinsulin and IGRP induces diabetes in non-obese diabetic (NOD) mice.)
|
- HY-P5514
-
|
Amylin (22-27) [NMeG24, NMeI26], human (IAPP)
|
Peptides
|
Others
|
|
NF(N-Me)GA(N-Me)IL is a biological active peptide. (This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis.)
|
- HY-P5745A
-
|
|
Peptides
|
Cancer
|
|
TYVPANASL TFA is a MHC I-binding CD8 T cell epitope of nine amino acids from HER2/neu. TYVPANASL TFA can be used to prepare J-LEAPS vaccine .
|
- HY-P5745
-
|
|
Transmembrane Glycoprotein
|
Cancer
|
|
TYVPANASL is a MHC I-binding CD8 T cell epitope of nine amino acids from HER2/neu. TYVPANASL can be used to prepare J-LEAPS vaccine .
|
- HY-P5881
-
|
|
PKC
|
Cardiovascular Disease
|
|
PKCα (C2-4) inhibitor peptide is a PKCα specific inhibitor peptide that blocks the inhibition of IKr by the α1A adrenoreceptor agonist A-61603 (HY-101366) .
|
- HY-P3206
-
|
Thymulin; Thymic factor
|
ERK
|
Neurological Disease
Inflammation/Immunology
Endocrinology
|
|
Serum thymic factor (Thymulin) is a zinc-dependent immunomodulatory peptide hormone, which can be produced by the thymic epithelial cells. Serum thymic factor stimulates the release of hormones from the pituitary gland, exhibits hypophysiotropic activity. Serum thymic factor protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor exhibits anti-diabetic, anti-inflammatory and analgesic effects. Serum thymic factor can be used in research about endocrine, reproductive, neurodegenerative and inflammatory diseases .
|
- HY-125295
-
|
|
Peptides
|
Others
|
|
Leucokinin I is a peptide that stimulates contraction of the anterior midgut and hindgut muscles involved in feeding in Rhodnius prolixus but not absorption in the anterior midgut .
|
- HY-P10077
-
- HY-P6028
-
|
|
Peptides
|
Others
|
|
GSNKSKPK-NH2 is a model peptide based on a c-Src N-terminal peptide that can be used as NMT substrate .
|
- HY-P6028A
-
|
|
Peptides
|
Others
|
|
GSNKSKPK-NH2 TFA is a model peptide based on a c-Src N-terminal peptide that can be used as NMT substrate .
|
- HY-P10185
-
- HY-P2606
-
- HY-P3030
-
|
|
Peptides
|
Inflammation/Immunology
|
|
CPN-219, a next-generation hexapeptidic NMUR2 agonist, achieves a dose-dependent and selective activation of NMUR2 with an EC50 value of 2.2 nM .
|
- HY-P10295
-
|
|
MDM-2/p53
|
Cancer
|
|
p53 (232-240) is a peptide segment of the 232-240 amino acid sequence of the human tumor suppressor protein p53. p53 (232-240) enhances its binding affinity to the Major histocompatibility complex (MHC), thereby enhancing the immunogenicity of this peptide to enhance the immune system's response to tumor antigens. p53 (232-240) can be used in the development of cancer vaccines and in the study of tumor cell recognition and clearance by the immune system .
|
- HY-P10433
-
|
|
Apoptosis
|
Cancer
|
|
EGFRvIII peptide is an EGFRvIII-derived epitope for binding to MHC I molecules. EGFRvIII peptide induces apoptosis, and causes specific immune responses against glioblastoma, especially in combination with Flagellin B .
|
- HY-P10542
-
|
|
Peptides
|
Cancer
|
|
Dodecapeptide AR71 is an inhibitor of melanoma inhibitory activity (MIA). Dodecapeptide AR71 can reduce cell migration, reduce metastasis formation, and increase immune response. Dodecapeptide AR71 can be used in research on the treatment of malignant melanoma .
|
- HY-P10509
-
|
|
Peptides
|
Infection
|
|
IE1 peptide refers to an antigenic peptide encoded by the immediate early (IE) gene of mouse cytomegalovirus (mCMV). IE1 peptide is one of the key antigenic peptides expressed during mCMV infection, plays a role in transcriptional activation in the life cycle of mCMV, and is one of the earliest genes expressed in the viral replication cycle. IE1 peptide is an important target for CD8+ T cell response and can be used to study the host immune response to mCMV infection .
|
- HY-P1711
-
|
|
Peptides
|
Cardiovascular Disease
|
|
L 366763 is a potent peptide that acts as a fibrinogen receptor antagonist, preventing collagen-induced platelet aggregation and adhesion. L 366763 inhibits platelet deposition and maintains blood flow in a baboon thrombosis model, significantly prolonging bleeding time. L 366763 has antithrombotic efficacy, whereas recombinant LAPP does not have the same effect .
|
- HY-P3206A
-
|
Thymulin acetate; Thymic factor acetate
|
ERK
|
Neurological Disease
Inflammation/Immunology
Endocrinology
|
|
Serum thymic factor acetate (Thymulin acetate) is the acetate salt form of Serum thymic factor (HY-P3206). Serum thymic factor acetate is a zinc-dependent immunomodulatory peptide hormone, which can be produced by the thymic epithelial cells. Serum thymic factor acetate stimulates the release of hormones from the pituitary gland, exhibits hypophysiotropic activity. Serum thymic factor acetate protects rats from Cephaloridine (HY-B2072)-induced nephrotoxicity by inhibiting ERK activation. Serum thymic factor acetate exhibits anti-diabetic, anti-inflammatory and analgesic effects. Serum thymic factor acetate can be used in research about endocrine, reproductive, neurodegenerative and inflammatory diseases .
|
- HY-P10607
-
|
|
EBV
|
Cancer
|
|
IALYLQQNW is a specific nonapeptide sequence derived from the tumor-associated antigen latent membrane protein 1 (LMP1) encoded by Epstein-Barr virus (EBV). As a latent T-cell epitope, IALYLQQNW is able to activate EBV-specific cytotoxic T lymphocytes (CTLs), which are able to recognize and kill EBV-infected cells expressing LMP1. IALYLQQNW plays an important role in the immune response against EBV-associated tumors and can be used in the study of Hodgkin's disease and nasopharyngeal carcinoma .
|
- HY-P10610
-
|
|
MDM-2/p53
|
Cancer
|
|
Peptide 234CM is a peptide containing isoleucine at position 3, corresponding to the sequence of a point mutation in p53 codon 234. Peptide 234CM induces potent cytotoxic T cell (CTL) and antitumor immune responses against mutant p53 .
|
- HY-P6355
-
|
|
Peptides
|
Inflammation/Immunology
|
|
CAP1-6D is an agonist peptide for cytotoxic T cell (CTL), that enhances the immunogenicity of the CAPI peptide, and stimulates T cell responses .
|
- HY-P2114
-
|
|
Peptides
|
Cancer
|
|
IT9302 is a synthetic IL-10 agonist with the activity of inducing tolerogenic dendritic cells. IT9302 is able to mimic multiple effects of IL-10, including downregulating the antigen presentation machinery and increasing the sensitivity of tumor cells to natural killer cell-mediated lysis. IT9302 can also hinder the response of human monocytes to differentiation factors and reduce the antigen presentation and co-stimulatory capacity of dendritic cells. Dendritic cells treated with IT9302 showed a weakened ability to stimulate T cell proliferation and interferon-γ production. IT9302 exerts its effects through mechanisms that are partially different from IL-10, involving STAT3 inactivation and regulation of the NF-κB intracellular pathway. IT9302-treated dendritic cells showed enhanced expression of membrane-bound TGF-β, associated with the effective induction of foxp3+ regulatory T cells .
|
- HY-P10799
-
- HY-P0245
-
- HY-P1487
-
|
|
Peptides
|
Neurological Disease
|
|
Pressinoic Acid is a synthetic hexapeptide with potent corticotrophin-releasing activity. Pressinoic Acid is also an oxytocin inhibitor; it induces maternal behavior.
|
- HY-P1495
-
- HY-P1580
-
|
|
Influenza Virus
|
Infection
|
|
PA (224-233), Influenza is a 10-aa peptide, a fragment of polymerase 2 protein in influenza A virus.
|
- HY-P1743
-
|
|
Peptides
|
Others
|
|
Acyl Carrier Protein (ACP) (65-74) is an active acyl carrier protein (ACP) fragment .
|
- HY-P1083A
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide TFA competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide TFA blocks the dopamine D3 effect on GABAA receptors .
|
- HY-P1083
-
|
|
Dynamin
|
Neurological Disease
|
|
Dynamin inhibitory peptide competitively blocks binding of dynamin to amphiphysin, thus preventing endocytosis. Dynamin inhibitory peptide blocks the dopamine D3 effect on GABAA receptors .
|
- HY-P4205
-
|
|
Aminopeptidase
|
Cancer
|
|
Aminopeptidase N Ligand (CD13) NGR peptide is a polypeptide targeting CD13 and can be used as a carrier to mediate intracellular transmission. Aminopeptidase N Ligand (CD13) NGR peptide is often used in cancer research .
|
- HY-P4820A
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
SYNV-cyclo(CGGYF) TFA is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) TFA inhibits S. aureus activity. SYNV-cyclo(CGGYF) TFA has the potential for the research of S. aureus-mediated epithelial damage and inflammation .
|
- HY-P4820
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
SYNV-cyclo(CGGYF) is a Staphylococcus hominis (S. hominis) C5 autoinducing peptide. SYNV-cyclo(CGGYF) inhibits S. aureus activity. SYNV-cyclo(CGGYF) has the potential for the research of S. aureus-mediated epithelial damage and inflammation .
|
- HY-P5452
-
|
|
PKC
|
Others
|
|
PKCd (8-17) is a biological active peptide. (This peptide is derived from the V1 domain of protein kinase C (PKC)d. It inhibits phorbol 12-myristate 13-acetate (PMA)-induced PKCd translocation and activation. Inhibition of PKCd reduces ischemia damage in cardiac and cerebral cells, induces proliferation of fibroblasts, and inhibits graft coronary artery disease in mice.)
|
- HY-P2714
-
- HY-P10054
-
|
|
Peptides
|
Others
|
|
SGKtide is used as an SGK(Serum and glucocorticoid-inducible kinase) substrate .
|
- HY-P10098
-
|
|
PKA
|
Cancer
|
|
PKA Substrate is a potent and selective substrate peptide of PKA that can be used to detect PKA activity .
|
- HY-P10430
-
|
|
Transmembrane Glycoprotein
|
Neurological Disease
|
|
Stalk peptide is a GPR110 activator. Stalk peptide is released from GPCR Autoproteolysis INducing domain by autocatalytic process and then Stalk peptide is inserted into the ligand-binding pocket of the receptor to activate the receptor. Stalk peptide can promote nerve growth and synaptic formation. Stalk peptide can be used to study neurodevelopmental and neurodegenerative diseases .
|
- HY-P10436
-
|
|
Raf
|
Cancer
|
|
Braftide is an allosteric inhibitor for BRAF kinase by targeting the dimer interface of BRAF kinase and inhibiting the formation of BRAF dimers. Braftide inhibits wild-type BRAF and oncogenic BRAF G469A with IC50 of 364 nM and 172 nM, respectively. Braftide inhibits MAPK signaling pathway, inhibits proliferation of KRAS mutant tumor cells (EC50 is 7.1 and 6.6 μM, for HCT116 and HCT-15), in combination of TAT sequence .
|
- HY-P10528
-
|
|
Peptides
|
Others
|
|
Echinotocin is a neuropeptide found in sea urchins that has muscle contractile activity. Echinotocin can cause contractions of the tube feet and esophagus of sea urchins. Echinotocin can be used to study the role of neuropeptides in invertebrate physiology and behavior .
|
- HY-P2138
-
|
|
HIV Protease
|
Others
|
|
U-85548E is an HIV protease inhibitor with nanomolar affinity for HIV-1 aspartic protease. By studying its structure-activity relationship, a potent nanomolar inhibitor with inhibitory effects on both HIV-1 and HIV-2 proteases was designed, and its binding mode was studied by X-ray crystallography and molecular modeling.
|
- HY-P0328
-
|
|
VSV
|
Infection
|
|
VSV-G Peptide is a 11 amino acid peptide derived from the Vesicular Stomatitis viral glycoprotein.
|
- HY-P0128
-
|
Amyloid beta-peptide (25-35); Aβ25-35; β-Amyloid peptide (25-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (25-35) (Amyloid beta-peptide (25-35)) is the fragment Aβ(25-35) of the Alzheimer's amyloid β-peptide, has shown neurotoxic activities in cultured cells .
|
- HY-P0241
-
- HY-P0150
-
- HY-P1879
-
- HY-P1843
-
|
|
Arenavirus
|
Infection
|
|
Glycoprotein (276-286) is a Db-restricted peptide derived from lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), corresponds to amino acids 276-286[1].
|
- HY-P2478
-
|
|
PD-1/PD-L1
|
Inflammation/Immunology
|
|
Human PD-L1 inhibitor V, a human PD-1 protein binding peptide with a Kd value of 3.32 μM. Human PD-L1 inhibitor V inhibit the interaction of hPD-1/hPD-L1 .
|
- HY-P0168
-
|
ARA290
|
Peptides
|
Neurological Disease
|
|
Cibinetide (ARA290) is an EPO-derivative, acting as a specific agonist of erythropoietin/CD131 heteroreceptor, and used for neurological disease treatment.
|
- HY-P5300
-
|
|
Peptides
|
Others
|
|
YNPCVMYL (Thioester: Cys4-Leu8) is a polypeptide chain of the YNPCVMYL sequence. The link between the fourth and eighth amino acids in the sequence has the properties of a thioester, which is formed between cysteine (Cys4) and leucine (Leu8).
|
- HY-P5300A
-
|
|
Peptides
|
Others
|
|
YNPCVMYL (Thioester: Cys4-Leu8) TFA is a polypeptide chain of the YNPCVMYL sequence. The link between the fourth and eighth amino acids in the sequence has the properties of a thioester, which is formed between cysteine (Cys4) and leucine (Leu8).
|
- HY-P1489F
-
|
|
Peptides
|
Others
|
|
FAM-OVA (257-264) is a biological active peptide. (FAM labeled HY-P1489)
|
- HY-P5389
-
|
|
Peptides
|
Others
|
|
Connexin mimetic peptide 40GAP27 is a biological active peptide. (This peptide corresponds to the GAP27 domain of the second extracellular loop of dominant vascular connexin (Cx40), designated as 40Gap 27. It was used to investigate mechanisms through which oxidant stress impairs communication via gap junctions. When administered, 40Gap27attenuates endothelium-dependent subintimal smooth muscle hyperpolarization.)
|
- HY-P5442
-
|
|
Peptides
|
Others
|
|
MOG (44-54), mouse, human, rat is a biological active peptide. (minimal binding epitope for the CD8 + MOG‐specific T cell)
|
- HY-103283
-
|
GRP(18-27) (porcine)
|
Biochemical Assay Reagents
|
Neurological Disease
|
|
Neuromedin C porcine (GRP, 18-27, porcine) is a bombesin-like neuropeptide that can be obtained from porcine spinal cord. Neuromedin C porcine exhibits a potent contractile activity on rat uterus in the characteristic manner of bombesin. Neuromedin C porcine has research potential for neurological-related diseases .
|
- HY-P1129
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
AR-M1896 is a GalR2 selective agonist with a binding IC50 of 1.76 nM for rat GalR2. AR-M1896 can be used for the research of acute myocardial infarction and neuropathic pain .
|
- HY-P5896
-
- HY-P4740
-
- HY-P5599
-
|
|
Bacterial
|
Infection
|
|
Temporin K is an antimicrobial peptide against Legionella pneumophila .
|
- HY-P5750
-
|
|
Peptides
|
Neurological Disease
|
|
Hypertrehalosemic neuropeptide (Nauphoeta cinerea) is a neuropeptide in the adipokinetic hormone/red pigment-concentrating hormone (AKH/RPCH) family, and can stimulate the synthesis of trehalose .
|
- HY-P5968
-
|
β(25-35)KA
|
Amyloid-β
|
Neurological Disease
|
|
[Ala28]-β Amyloid(25-35) (β(25-35)KA) is an electrically neutral mutant peptide of Aβ(25-35) that accelerates the aggregation of Firefly Luciferase .
|
- HY-P5991
-
|
|
Peptides
|
Cardiovascular Disease
|
|
K-Casein (106-116),bovine is a peptide that inhibits platelet aggregation and fibrinogen binding, plays an important role in atherosclerosis .
|
- HY-P10097
-
|
|
VEGFR
|
Others
|
|
Flt2 11 is a anti‐angiogenic peptide, and specifically binds NRP‐1. Flt2 11 inhibits NRP‐1/sVEGFR‐1 interaction.
|
- HY-P10196
-
|
|
Peptides
|
Others
|
|
DABCYL-SEVNLDAEF-EDANS is a substrate of FRET. DABCYL-SEVNLDAEF-EDANS can be used in the BACE activity assay .
|
- HY-P10521
-
|
|
VEGFR
|
Cancer
|
|
Apolipoprotein KV domain (67-77) is an 11-amino acid peptide identified from the KV domain of human apolipoprotein a (ApoA) with antiangiogenic and antitumor activities. Apolipoprotein KV domain (67-77) targets the angiogenic c-Src/ERK pathway by blocking activation signals received from vascular endothelial growth factor (VEGF). Apolipoprotein KV domain (67-77) can be used in cancer research .
|
- HY-P3134
-
|
|
Peptides
|
Metabolic Disease
|
|
CPN-267 (compound 7b) is a selective neuromedin U receptor 1 (NMUR1) agonist with the EC50 of 0.25 nM. CPN-267 suppresses body weight gain in mice and can be used for study of obesity .
|
- HY-P1729
-
- HY-P1761
-
|
|
Peptides
|
Neurological Disease
|
|
Prepro VIP (111-122), human is a prepro-vasoactive intestinal polypeptide (VIP)–derived peptide, corresponding to residues 111-122. VIP is present in the peripheral and the central nervous systems where it functions as a nonadrenergic, noncholinergic neurotransmitter or neuromodulator .
|
- HY-P1823
-
|
|
Akt
mTOR
Caspase
|
Infection
Cardiovascular Disease
Metabolic Disease
Inflammation/Immunology
Cancer
|
|
C-Reactive Protein (CRP) is an anti-pneumococcal plasma protein that can serve as an inflammatory marker. C-Reactive protein can protect mice from pneumococcal infection by activating complement. C-Reactive protein can inhibit the activation of caspase-3/9 through the CD64/AKT/mTOR pathway, thereby promoting chemotherapy resistance in mice with tongue squamous cell carcinoma .
|
- HY-P1344
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
- HY-P1344A
-
|
|
DAPK
|
Cancer
|
|
DAPK Substrate Peptide TFA is a synthetic peptide substrate for death associated protein kinase (DAPK), with a Km of 9 μM .
|
- HY-P1163A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
D[LEU4,LYS8]-VP TFA is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP TFA has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P1163
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
D[LEU4,LYS8]-VP is a selective agonist of vasopressin V1b receptor, with the Kis of 0.16 nM, 0.52 nM, and 0.1.38 nM for rat, human and mouse V1b receptor, respectively. D[LEU4,LYS8]-VP has weak antidiuretic, vasopressor, and in vitro oxytocic activities .
|
- HY-P1191
-
|
TI-JIP; JIP-1 peptide; JIPtide
|
JNK
|
Others
|
|
JIP-1(153-163) (TI-JIP) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
- HY-P1191A
-
|
TI-JIP TFA; JIP-1 peptide TFA; JIPtide TFA
|
JNK
|
Others
|
|
JIP-1(153-163) TFA (TI-JIP TFA) is a peptide inhibitor of c-JNK, based on residues 153-163 of JNK-interacting protein-1 (JIP-1) (Modifications: Phe-11 = C-terminal amide) .
|
- HY-P3419
-
- HY-146127
-
|
|
EGFR
|
Others
|
|
Grb2 SH2 domain inhibitor 1 is a conformationally restricted cyclic cell penetrating peptide (CPP) containing d-pro-l-pro motif ring (AF Φ Rpprrfq) (where Φ It is L-naphthylalanine, R is D-arginine, P is D-proline), which is mainly used as a cyclic peptide inhibitor.
|
- HY-P3929A
-
|
|
PKA
|
Cancer
|
|
PKI (14-24)amide TFA is a potent PKA inhibitor. PKI (14-24)amide strongly inhibited cyclic AMP-dependent protein kinase activity in the cell homogenate .
|
- HY-P4683
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a potent vasopressin V1 receptor (VP V1R) antagonist. (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin significantly decreases the mean arterial pressure (MAP) in rats .
|
- HY-P4237
-
- HY-P4847
-
|
|
Peptides
|
Others
|
|
pTH (73-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4801
-
|
Human PACAP(28-38)
|
Peptides
|
Others
|
|
PACAP-38 (28-38) (human, chicken, mouse, ovine, porcine, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4714
-
|
|
Peptides
|
Others
|
|
(Tyr27)-α-CGRP (27-37) (canine, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-148663
-
|
Tripalmitoyl pentapeptide
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
Mitogenic Pentapeptide (Tripalmitoyl pentapeptide) is an effective activator of B lymphocyte mitogen and polyclonal. Mitogen Pentapeptide is a synthetic N-terminal analog of E. coli outer membrane lipoproteins (cysteinyl-seryl-seryl-asparaginyl-alanine). Mitogenic Pentapeptide can be used for the study of immune adjuvants .
|
- HY-P5082
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein 4554W is an inhibitor of α-Synuclein (aSyn) aggregation with associated toxicity. α-Synuclein 4554W consists of GIVNGVKA sequences, previously identified through intracellular library screening. α-Synuclein 4554W reduces fibril formation of aSyn mutants assocaited with Parkinson’s disease .
|
- HY-146127A
-
|
|
Peptides
|
Others
|
|
Grb2 SH2 domain inhibitor 1 TFA is a conformationally restricted cyclic cell penetrating peptide (CPP) containing d-pro-l-pro motif ring (AF Φ Rpprrfq) (where Φ It is L-naphthylalanine, R is D-arginine, P is D-proline), which is mainly used as a cyclic peptide inhibitor.
|
- HY-P3419A
-
- HY-P5352
-
|
|
Peptides
|
Others
|
|
Hyaluronan-IN-1 is a biological active peptide. (This 12 amino acids peptide is a hyaluronan inhibitor (HA), a high molecular weight glycosaminoglycan expressed abundantly in the extracellular matrix and on cell surfaces. This peptide shows specific binding to soluble, immobilized, and cell-associated forms of HA, and it inhibits leukocyte adhesion to HA substrates almost completely.)
|
- HY-P4943
-
- HY-P4960
-
- HY-P5261
-
|
KP1
|
Peptides
|
Metabolic Disease
|
|
SA1-III(KP1) is a bioactive peptide withanti-agingeffect and has been reported used as a cosmetic ingredient .
|
- HY-P0128F
-
- HY-P10037
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β Amyloid(17-28) human is a β-amyloid peptide (Abeta), a lipid-induced amyloid core fragment. β Amyloid(17-28) human enhances aggregation of full-length β Amyloid40, producing toxic aggregates in Alzheimer's disease (AD) .
|
- HY-P10128
-
|
|
Peptides
|
Inflammation/Immunology
|
|
GE11 is a active peptide and combines with colloidal drug delivery systems as smart carriers for antitumor drugs and can be used for cancer study .
|
- HY-P10179
-
- HY-P4683A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin is a potent vasopressin V1 receptor (VP V1R) antagonist. (Phenylac1,D-Tyr(Et)2,Lys6,Arg8,des-Gly9)-Vasopressin significantly decreases the mean arterial pressure (MAP) in rats .
|
- HY-P10119
-
|
|
PDGFR
|
Others
|
|
PDGFR Y1021 peptide (non-phosphorylation) is the non-phosphorylated fragment of platelet-derived growth factor receptor (PDGFR). PDGFR Y1021 peptide (non-phosphorylation) blocks the PLCγ association to PDGFR through PLCγSH2 domain, and thus inhibits mitogenic response .
|
- HY-P10270
-
|
|
Peptides
|
Others
|
|
PDGFR Y1021 peptide (phosphorylation) is the phosphorylated fragment of platelet-derived growth factor receptor (PDGFR). PDGFR Y1021 peptide (phosphorylation) supports association of PLCγ to PDGFR through PLCγSH2 domains, and thus promotes the production of inositol phosphates and mitogenic response .
|
- HY-P10282
-
|
|
CaMK
|
Neurological Disease
|
|
Synapsin I-(3-13), a substrate for CaMK1, is a glycoprotein. Synapsin I is a phosphoprotein that coats the cytoplasmic side of synaptic vesicles and regulates their trafficking within nerve terminals .
|
- HY-P10286
-
|
|
MDM-2/p53
|
Cancer
|
|
Phage-derived 12/1 peptide exhibits antitumor activity by targeting MDM2 and MDMX, an thus disrupt the MDM2-p53 and MDMX-p53 interaction, with IC50 of 0.15 and 1.25 μM .
|
- HY-P10425
-
|
|
Peptides
|
Cancer
|
|
T2857W is a mutant peptide that has inhibitory effect on KIX-MLL interaction (IC50=5.67 μM). T2857W can be used for protein-protein interaction (PPI) and for the study of diseases related to KIX-MLL interaction, such as leukemia, cancer, etc .
|
- HY-P10552
-
|
|
CXCR
|
Inflammation/Immunology
|
|
pCXCL8-1aa is an anti-inflammatory peptide. pCXCL8-1aa competitively inhibits the binding of CXCL8 to glycosaminoglycans such as heparin sulfate (HS) by binding with high affinity. This reduces the presentation of CXCL8 on the surface of vascular endothelial cells, thereby inhibiting neutrophil migration and inflammatory responses. pCXCL8-1aa can be used to study inflammatory diseases such as rheumatoid arthritis .
|
- HY-P10645
-
|
|
Peptides
|
Cardiovascular Disease
|
|
T9 peptide (SKTFNTHPQSTP) is a muscle targeting peptide. T9 peptide binds strongly to C2C12 myoblasts. T9 peptide is capable of increased specificity for the heart and quadriceps muscles if conjugated to oligonucleotides without a similar effect in targeting to the kidney, liver, and diaphragm.
|
- HY-P10848
-
|
|
Bacterial
|
Infection
|
|
RJPXD33 is the inhibitor for LpxD and LpxA with IC50 of 3.5 μM and 19 μM. RJPXD33 RJPXD33 inhibits LpxD and LpxA in E. coli with Kd of 6 μM and 20 μM .
|
- HY-17571A
-
|
α-Hypophamine acetate; Oxytocic hormone acetate
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine) acetate is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin acetate can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
- HY-P0234
-
|
|
Neurotensin Receptor
|
Endocrinology
Cancer
|
|
Neurotensin, a gut tridecapeptide, acts as a potent cellular mitogen for various colorectal and pancreatic cancers which possess high-affinity neurotensin receptors (NTR).
|
- HY-P1746
-
|
PKC (19-31)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31), a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31), is used as protein kinase C substrate peptide for testing the protein kinase C activity .
|
- HY-P1749
-
|
|
Influenza Virus
|
Infection
|
|
Influenza HA (307-319) is 13 amino acids 307 to 319 fragment of Influenza HA. Influenza HA is a glycoprotein found on the surface of influenza viruses .
|
- HY-P1774
-
|
|
HBV
|
Infection
|
|
Hepatitis B Virus Core (128-140) is a peptide of hepatitis B virus core protein.
|
- HY-P1746A
-
|
PKC (19-31) (TFA)
|
PKC
|
Inflammation/Immunology
|
|
Protein Kinase C (19-31) TFA, a peptide inhibitor of protein kinase C (PKC), derived from the pseudo-substrate regulatory domain of PKCa (residues 19-31), is used as protein kinase C substrate peptide for testing the protein kinase C activity .
|
- HY-P1390
-
|
|
Vasopressin Receptor
|
Endocrinology
|
|
d[Cha4]-AVP is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P1390A
-
|
|
Vasopressin Receptor
|
Endocrinology
|
|
d[Cha4]-AVP TFA is a potent and selective vasopressin (AVP) V1b receptor agonist with a Ki of 1.2 nM for human V1b receptor. d[Cha4]-AVP TFA shows more selective for V1b receptor than human V1a receptor, V2 receptor, and oxytocin receptors .
|
- HY-P2198A
-
- HY-P1052
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Myelin Basic Protein(87-99) is an encephalitogenic peptide that induces basic protein-specific T cell proliferation. Myelin Basic Protein(87-99) causes a Th1 polarization in peripheral blood mononuclear cells with is implicated of multiple sclerosis (MS) .
|
- HY-P1052A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Myelin Basic Protein(87-99) TFA is an encephalitogenic peptide that induces basic protein-specific T cell proliferation. Myelin Basic Protein(87-99) TFA causes a Th1 polarization in peripheral blood mononuclear cells with is implicated of multiple sclerosis (MS) .
|
- HY-P2548
-
|
|
EGFR
|
Others
|
|
pp60 (v-SRC) Autophosphorylation Site, Phosphorylated is the phosphorylated peptide of an EGFR substrate. pp60 (v-SRC) Autophosphorylation Site, Phosphorylated can be used for the screening of EGFR Kinase inhibitors via phosphorylated-substrate quantification .
|
- HY-P3218
-
|
|
Peptides
|
Endocrinology
|
|
[Glu4]-Oxytocin is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of “oxytocin-like” molecules in aqueous solution .
|
- HY-P3221
-
|
|
Peptides
|
Endocrinology
|
|
[Leu3]-Oxytocin, an oxytocin analogue, is derived by structural variation in sequence position 3 replaced by leucine (Leu) .
|
- HY-P3744
-
|
|
Peptides
|
Others
|
|
pp60v-src Autophosphorylation site is a synthetic peptide. pp60v-src Autophosphorylation site can be used for various biochemical studies .
|
- HY-P4008
-
|
dVDAVP
|
Peptides
|
Endocrinology
|
|
[Deamino-4-valine, 8-D-arginine]-Vasopressin (dVDAVP) is a highly potent and specific antidiuretic agent possessing protracted effects .
|
- HY-P4133
-
|
|
ERK
MEK
|
Cancer
|
|
MEK1 Derived Peptide Inhibitor 1 is a peptide inhibitor. MEK1 Derived Peptide Inhibitor 1 can inhibit the in vitro activation of ERK2 by MEK1 with an IC50 value of 30 μM. MEK1 Derived Peptide Inhibitor 1 can be used for the research of cell-permeable .
|
- HY-P3218A
-
|
|
Peptides
|
Endocrinology
|
|
[Glu4]-Oxytocin acetate is an appropriate derivative of oxytocin for conducting a comprehensive investigation by a variety of methods of the conformation of oxytocin-like molecules in aqueous solution .
|
- HY-P4699
-
|
|
JNK
|
Others
|
|
(Thr17)-c-Jun (11-23) is a fragment peptide of c-Jun.
|
- HY-P5755
-
|
|
Peptides
|
Cancer
|
|
SWELYYPLRANL-NH2 is an E-cadherin and N-cadherin antagonist. SWELYYPLRANL-NH2 inhibits phage clone binding to E- or N-cad/Fc chimeric protein (IC50: 0.7 and 0.09 μM respectively). SWELYYPLRANL-NH2 inhibits cell aggregation. SWELYYPLRANL-NH2 can be used to promote drug delivery through epithelial and endothelial permeability barriers .
|
- HY-P5755A
-
|
|
Peptides
|
Cancer
|
|
SWELYYPLRANL-NH2 TFA is an E-cadherin and N-cadherin antagonist. SWELYYPLRANL-NH2 TFA inhibits phage clone binding to E- or N-cad/Fc chimeric protein (IC50: 0.7 and 0.09 μM respectively). SWELYYPLRANL-NH2 TFA inhibits cell aggregation. SWELYYPLRANL-NH2 can be used to promote drug delivery through epithelial and endothelial permeability barriers .
|
- HY-P5258
-
|
|
EGFR
|
Metabolic Disease
|
|
Oligopeptide-41 is a bioactive peptide with promotion of hair growth effect and has been reported used as a cosmetic ingredient .
|
- HY-P4777
-
|
Dabcyl-CMV-Edans
|
Fluorescent Dye
|
Infection
|
|
Dabcyl-RGVVNASSRLA-Edans (Dabcyl-CMV-Edans) is a fluorogenic substrate for human cytomegalovirus (HCMV) protease .
|
- HY-P10063
-
- HY-P10072
-
|
Hsp25 kinase inhibitor; Mk2 pseudosubstrate
|
ERK
JNK
p38 MAPK
HSP
MAPKAPK2 (MK2)
|
Others
|
|
MK2-IN-5 is a Mk2 pseudosubstrate (Ki= 8 μM). MK2-IN-5 targets the protein interaction domain in the MAPK pathway. MK2-IN-5 inhibits HSP25 and HSP27 phosphorylation .
|
- HY-P2023
-
|
|
Peptides
|
Others
|
|
Hirugen is a derivative of hirudin, an anticoagulant protein found in leeches .
|
- HY-P10186
-
- HY-P10178
-
- HY-17571
-
|
α-Hypophamine; Oxytocic hormone
|
Oxytocin Receptor
Endogenous Metabolite
|
Endocrinology
Cancer
|
|
Oxytocin (α-Hypophamine; Oxytocic hormone) is a pleiotropic, hypothalamic peptide known for facilitating parturition, lactation, and prosocial behaviors. Oxytocin can function as a stress-coping molecule with anti-inflammatory, antioxidant, and protective effects especially in the face of adversity or trauma .
|
- HY-P10072A
-
|
Hsp25 kinase inhibitor acetate; Mk2 pseudosubstrate acetate
|
JNK
HSP
MAPKAPK2 (MK2)
p38 MAPK
ERK
|
Others
|
|
MK2-IN-5 (Hsp25 kinase inhibitor) acetate is a Mk2 pseudosubstrate (Ki= 8 μM). MK2-IN-5 acetate targets the protein interaction domain in the MAPK pathway. MK2-IN-5 acetate inhibits HSP25 and HSP27 phosphorylation .
|
- HY-125745
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Loloatin B 10 is an antibiotic, which exhibits antibacterial efficacy against gram positive antibiotic resistant human pathogens .
|
- HY-P10367
-
|
|
MAPKAPK2 (MK2)
Checkpoint Kinase (Chk)
AMPK
|
Others
|
|
Ziptide is a substrate for MAPK activated protein kinase 2 (MAPKAPK2, Km = 5 μM), MAPKAPK3 (Km = 30 μM), PARK (Km = 40 μM), checkpoint kinase 1 (Chk1, Km = 5 μM), AMP-activated protein kinase (AMPK, Km = 75 μM), and calcium/calmodulin-dependent protein kinase II (CamKII, Km = 300 μM) .
|
- HY-P10364
-
|
UBI(29-41)
|
Bacterial
Antibiotic
|
Inflammation/Immunology
|
|
Ubiquicidin(29-41) is an antimicrobial peptide highly homologous to S30. Ubiquicidin(29-41) targets bacterial and fungal. Ubiquicidin(29-41) can be used as a membrane-specific infection localizer .
|
- HY-P10486
-
|
|
Bacterial
|
Infection
|
|
AIP-II is a macrocyclic peptide signaling molecule used for quorum sensing, which can be produced be Staphylococcus aureus. AIP-II binds to AgrC-II receptor, regulates the virulence gene expression in Staphylococcus aureus. AIP-II is an antagonist for AgrC-I receptor .
|
- HY-P10511
-
|
|
Apoptosis
|
Infection
Cancer
|
|
Pantinin-3 is an antimicrobial peptide with antitumor activity found in the venom of the emperor scorpion (Pandinus imperator). Pantinin-3 shows selective toxicity against breast cancer cells (MDA-MB-231) and prostate cancer cells (DU-145). Pantinin-3 can induce apoptosis in tumor cells. Pantinin-3 can be used in cancer research .
|
- HY-159064S
-
|
|
Isotope-Labeled Compounds
|
Others
|
|
DSPSAPVNVT(Val- 13C5, 15)R TFA is the 13C and 15N-labeled DSPSAPVNVT(Val)R. Radioactive isotopes labeled compounds can be used in metabolic analysis, allowing the movement of individual atoms to be precisely tracked and quantified .
|
- HY-P10603
-
|
|
Peptides
|
Infection
|
|
SP1 is an α-peptide encoded by the mating pheromone MFα1 gene in Candida albicans, which can induce cell growth arrest at the mating type locus MTLa in Candida albicans. SP1 can be used in the study of the prevention and treatment of Candida albicans infection .
|
- HY-P10609
-
|
|
Btk
|
Others
|
|
Btk substrate peptide is a peptide substrate corresponding to residues 217-229 of human Bruton’s tyrosine kinase (Btk), of which the tyrosine at residue 223 is the major autophosphorylation site of Btk. Btk substrate peptide is used as a substrate in in vitro kinase assays to evaluate the activity of Btk or other tyrosine kinases .
|
- HY-P0049
-
|
Arg8-vasopressin; AVP
|
Vasopressin Receptor
|
Neurological Disease
Cancer
|
|
Argipressin (Arg8-vasopressin) binds to the V1, V2, V3-vascular arginine vasopressin receptor, with a Kd value of 1.31 nM in A7r5 rat aortic smooth muscle cells for V1.
|
- HY-A0182
-
- HY-P0004
-
|
Lysine vasopressin; [Lys8]-Vasopressin
|
Adenylate Cyclase
|
Others
|
|
Lysipressin (Lysine vasopressin) is antidiuretic hormone that have been found in pigs and some marsupial families. Lysipressin induces contraction of the rabbit urinary bladder smooth muscle, activate adenylate-cyclase .
|
- HY-P0083
-
- HY-P0325
-
|
|
Peptides
|
Others
|
|
V5 Epitope Tag Peptide (TFA) is a tag peptide derived from a small epitope present on the P and V proteins of the paramyxovirus of simian virus 5.
|
- HY-P1474
-
|
Amyloid β-Protein (22-35)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid 22-35 (Amyloid β-Protein 22-35), the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution) .
|
- HY-P1486
-
|
|
Endogenous Metabolite
|
Cardiovascular Disease
|
|
Angiotensinogen (1-14), human is a fragment of the renin substrate angiotensinogen. Angiotensinogen is naturally occurring substrate for renin and a precursor for all angiotensin peptides .
|
- HY-P1574
-
|
Vasotocin, Argiprestocin, Arginine vasotocin
|
Peptides
|
Neurological Disease
|
|
[Arg8]-Vasotocin is a vertebrate neurohypophyseal peptide of the vasopressin/oxytocin hormone family .
|
- HY-P1574A
-
- HY-P1737
-
|
Con-S
|
Peptides
|
Cardiovascular Disease
|
|
Conopressin S, isolated from Conus striatus, shows high affinity with vasopressin V1b receptor (AVPR1B), with a Ki of 8.3 nM .
|
- HY-P1754
-
|
|
Peptides
|
Neurological Disease
|
|
Tetanus toxin (830-843) is a powerful neurotoxin that reaches by retroaxonal transport and transcytosis the cytoplasm ofspinal inhibitory intemeurons and blocks their ability to release neurotransmitters .
|
- HY-P1828
-
|
|
Peptides
|
Cancer
|
|
EGFRvIII peptide (PEPvIII) is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide represents a truly tumor-specific target for antitumor immunotherapy .
|
- HY-P1870
-
- HY-P1869
-
- HY-A0182A
-
|
PLV-2 acetate
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Felypressin acetate (PLV-2 acetate) is a non-catecholamine vasoconstrictor and a vasopressin 1 agonist. Felypressin acetate is widely used in dental procedures .
|
- HY-P1474A
-
|
Amyloid β-Protein (22-35) (TFA)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid 22-35 (Amyloid β-Protein 22-35) TFA, the residues 22-35 fragment ofβ-amyloid protein, has a cytotoxic effect on cultured neurons from the rat hippocampus in serum-free medium. β-Amyloid 22-35 TFA forms aggregates and typical amyloid fibrils resembling those of the β-amyloid protein in neutral buffer solution) .
|
- HY-P1754A
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Tetanus toxin (830-843) TFA is a powerful neurotoxin that reaches by retroaxonal transport and transcytosis the cytoplasm ofspinal inhibitory intemeurons and blocks their ability to release neurotransmitters .
|
- HY-P2515
-
|
|
Peptides
|
Others
|
|
Transcriptional Intermediary Factor 2 (TIF2) (740-753) is a TIF-2 coactivator peptide composed of 14 amino acids and covers the residue range 740-753 of TIF-2 protein .
|
- HY-P0118A
-
|
P144 TFA
|
TGF-beta/Smad
PI3K
Apoptosis
|
Cancer
|
Disitertide (P144) TFA is a peptidic transforming growth factor-beta 1 (TGF-β1) inhibitor specifically designed to block the interaction with its receptor. Disitertide TFA is also a PI3K inhibitor and an apoptosis inducer .
|
- HY-P3057
-
- HY-B1811
-
|
|
Endogenous Metabolite
|
Neurological Disease
|
|
Vasopressin is a cyclic nonapeptide that is synthesized centrally in the hypothalamus. Vasopressin participates in the hypothalamic-pituitary-adrenal axis, and regulates pituitary corticotropin secretion by potentiating the stimulatory effects of corticotropin releasing factor. Vasopressin also can act as a neurotransmitter, exerting its action by binding to specific G protein-coupled receptors .
|
- HY-P4136
-
|
|
ERK
|
Cancer
|
|
Myristoyl-MEK1 Derived Peptide Inhibitor 1 is the myristoylated form of the MEK1 Derived Peptide Inhibitor 1 (HY-P4133). Myristoyl-MEK1 Derived Peptide Inhibitor 1 inhibits ERK activation with an IC50 of 10 μM .
|
- HY-P4678
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P4184
-
|
(Ser4,Ile8)-Oxytocin
|
Peptides
|
Others
|
|
Isotocin ((Ser4,Ile8)-Oxytocin) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4605
-
- HY-P4832
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Acetyl-Tau Peptide (273-284) amide is an acetylated Tau peptide fragment. Acetyl-Tau Peptide (273-284) amide limits the substantial aggregation of Ac-Aβ(25–35)-NH2 and can be used as an inhibitor of Ac-Aβ(25–35)-NH2. Acetyl-Tau Peptide (273-284) amide can be used as an experimental model to investigate the Aβ/Tau cross-interaction .
|
- HY-P4917
-
|
SST 14
|
Peptides
|
Others
|
|
Somatostatin-14 (reduced) (SST 14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4678A
-
|
|
Vasopressin Receptor
|
Neurological Disease
|
|
(Phe2,Orn8)-Oxytocin acetate is a selective V1 vasopressin agonist. (Phe2,Orn8)-Oxytocin acetate induces a sustained contractility of rabbit epididymis with EC50 value of 280 nM .
|
- HY-P3833A
-
- HY-P1828A
-
|
|
EGFR
|
Cancer
|
|
EGFRvIII peptide (PEPvIII) TFA is a tumor-specific mutation that is widely expressed in glioblastoma multiforme (GBM) and other neoplasms and its expression enhances tumorigenicity. EGFRvIII peptide TFA represents a truly tumor-specific target for antitumor immunotherapy .
|
- HY-P4990
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P4994
-
- HY-P5017
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(Val3,Pro8)-Oxytocin is the Gq-dependent pathway agonist. (Val3,Pro8)-Oxytocin is also a weaker agonist for the β-arrestin engagement and endocytosis toward the oxytocin receptor (OXTR) .
|
- HY-P4920
-
|
|
Fluorescent Dye
|
Others
|
|
Mca-SEVNLDAEFK(Dnp)-NH2 contains a highly fluorescent 7-methoxycoumarin group that is efficiently quenched by resonance energy transfer to the 2,4-dinitrophenyl group. It can be used to measure the activities of peptidases that are capable of cleaving an amide bond between the fluorescent group and the quencher group, causing an increase in fluorescence, such as can be used to measure the activity of BACE-1 .
|
- HY-P5166
-
|
|
Peptides
|
Others
|
|
Lys-Conopressin-G, a vasotocin-like peptide, can be isolated from the venom of the worm-hunting snail (conus imperialis) .
|
- HY-P5208
-
|
|
Peptides
|
Cancer
|
|
CBLB 612 is an anti-radiation agent. CBLB 612 can be used in the propagation of mouse and monkey moderate stimulation hematopoietic stem cell (HSC), and lure that they are passed to peripheral blood from bone marrow into. CBLB 612 is an important auxiliary agent for cancer .
|
- HY-P4990A
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
Pro8-Oxytocin TFA is a a modified oxytocin (OXT) ligand. Pro8-Oxytocin produces more potent and efficacious responses at primate OXTR and stronger behavioral effects than the consensus mammalian OXT ligand (Leu8-Oxytocin). Pro8-Oxytocin TFA produce a less efficacious response than Vasopressin (HY-B1811) (AVP) at human AVPR1a and higher efficacious response than AVP at marmoset AVPR1a .
|
- HY-P5451
-
|
|
Peptides
|
Others
|
|
PLP (178-191) is a biological active peptide. (This is amino acids 178 to 191 fragment of the proteolipid protein (PLP), an immunodominant encephalitogenic epitope in SJL mice, one of two major encephalitogenic epitopes. PLP peptide 178 to 191 was compared with another encephalitogenic peptide, 139 to 151. The day of onset of disease induced by PLP 178 to 191 was earlier, but the incidence, severity, and histologic features were indistinguishable.)
|
- HY-P4184A
-
|
(Ser4,Ile8)-Oxytocin acetate
|
Peptides
|
Others
|
|
Isotocin (acetate) ((Ser4,Ile8)-Oxytocin (acetate)) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5592
-
|
|
Bacterial
|
Infection
|
|
Temporin B is an antimicrobial peptide against Legionella pneumophila .
|
- HY-P5598
-
|
|
Bacterial
|
Infection
|
|
Temporin G is an antimicrobial peptide against Legionella pneumophila .
|
- HY-P4978
-
|
|
Checkpoint Kinase (Chk)
|
Cancer
|
|
CBP501 Affinity Peptide is a Chk kinase inhibitor that can abrogate G2 arrest induced by DNA-damaging agents. CBP501 Affinity Peptide can be used in cancer research .
|
- HY-P5717
-
|
|
Peptides
|
Infection
|
|
Peptide 12d is an antimicrobial peptide isolated from the venom of wasp. Peptide 12d mediates antimicrobial response by stimulating mast cell degranulation .
|
- HY-P0128F1
-
|
|
Amyloid-β
|
Neurological Disease
|
|
FITC-β-Ala-β-Amyloid (25-35) is a fluorescent product labeled by FITC that can be used in Alzheimer's disease research .
|
- HY-P5998
-
|
|
Myosin
|
Cancer
|
|
Myosin Light Chain Kinase Substrate (smooth muscle) is a smooth muscle myosin light chain kinase (MLCK) synthetic peptide substrate .
|
- HY-P10044
-
|
|
Peptides
|
Others
|
|
IGF1Rtide can be used as a RET kinase substrate for RET kinase assays .
|
- HY-P5866
-
|
Manse-AT
|
Endogenous Metabolite
|
Endocrinology
|
|
Allatotropin (Manse-AT) is a 13 amino acid neuropeptide. Allatotropin activates inositol 1,4,5-trisphosphate (IP3) pathway, and the biosynthesis of juvenile hormone (JH) in Manduca sexta .
|
- HY-P10307
-
- HY-P0083A
-
- HY-P2223
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
Hypeptin is a cyclo-deposited peptide antibiotic produced by Lysobacter sp.K5869. Hypeptin blocks bacterial cell wall biosynthesis by binding to multiple undecaprenyl pyrophosphate-containing biosynthesis intermediates, forming a stoichiometric 2:1 complex. Hypeptin has antibacterial activity .
|
- HY-P10604
-
|
|
Peptides
|
Others
|
|
SP2 is a 14-amino acid long active peptide that can induce growth arrest in MTLa cells of the mating type locus of Candida albicans .
|
- HY-P10612
-
|
|
Peptides
|
Metabolic Disease
|
|
Tetanus toxin peptide is a specific peptide isolated from the toxin produced by Clostridium tetani. Tetanus toxin peptide can be used as an immunogen to induce diabetes in mice. Tetanus toxin peptide can be used in the study of type 1 diabetes .
|
- HY-P4917A
-
|
SST 14 TFA
|
Peptides
|
Inflammation/Immunology
|
|
Somatostatin-14 (reduced) (SST 14) (TFA) is a peptide that can be discovered through peptide screening. Peptide screening is a research tool primarily used for identifying active peptides through immunoassays. It can be employed in protein interactions, functional analysis, antigen epitope screening, and is particularly useful in the research and development of active molecules .
|
- HY-P4605A
-
- HY-P0195
-
- HY-P0258
-
- HY-P0246
-
|
|
Peptides
|
Metabolic Disease
|
|
Mastoparan, a tetradecapeptide which is a component of wasp venom, stimulates release of prolactin from cultured rat anterior pituitary cells.
|
- HY-P1516
-
- HY-P1048
-
- HY-P1516A
-
- HY-P1797A
-
|
|
Peptides
|
Others
|
|
Sakamototide substrate peptide TFA is a peptide substrate for members of the AMPK family of kinases, used in kinase activity assays .
|
- HY-P1948
-
|
|
Peptides
|
Inflammation/Immunology
Cancer
|
|
Thioredoxin reductase peptide corresponds to residues 53–67 in thioredoxin reductase (TrxR), used in thioredoxin reductase research. Thioredoxin reductase acts as a reductant of disulfide-containing proteins and plays crucial role in cellular antioxidant defense .
|
- HY-P2161A
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 TFA is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 TFA is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 TFA depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P2161
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P2161B
-
|
|
Kisspeptin Receptor
|
Cancer
|
|
TAK-683 acetate is a potent full KISS1 receptor (KISS1R) agonist (IC50=170 pM) with improved metabolic stability. TAK-683 acetate is a nonapeptide metastin analog, exhibits agonistic activities to KISS1R with EC50 values of 0.96 nM and 1.6 nM for human and rat, respectively . TAK-683 acetate depletes GnRH in the hypothalamus and reduces plasma FSH, LH, and testosterone levels in vivo, it has the potential for the study of hormone-dependent prostate cancer .
|
- HY-P3532
-
|
[pGlu1]-FGL peptide acetate; [Pyr1]-FGL peptide acetate
|
Peptides
|
Neurological Disease
|
|
[Glp1]-FGL peptide acetate is a neural cell adhesion molecule (NCAM) derived motif and can be used for the research of neurogenesis .
|
- HY-P3281
-
|
|
Biochemical Assay Reagents
|
Others
|
|
FGL peptide, is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4916
-
|
|
Peptides
|
Others
|
|
Somatostatin-14 (3-14) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4935
-
|
|
Peptides
|
Others
|
|
Tau Peptide (268-282) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4961
-
|
|
Peptides
|
Others
|
|
Tau Peptide (295-309) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5010
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
(D-Arg8)-Inotocin is a potent, selective and competitive antagonist of vasopressin receptor (V1aR), with a Ki of 1.3 nM. (D-Arg8)-Inotocin shows more than 3000-fold selectivity for the human V1aR over the other three subtypes, OTR, V1bR and V2R .
|
- HY-17571F
-
|
Biotin-α-Hypophamine; Biotin-Oxytocic hormone
|
Peptides
|
Others
|
|
Biotin-Oxytocin (Biotin-α-Hypophamine; Biotin-Oxytocic hormone) is a biological active peptide. (This is Oxytocin (HY-17571) N-terminally labeled with Biotin.)
|
- HY-P5334
-
|
|
Peptides
|
Neurological Disease
|
|
AADvac 1 is an active tau peptide vaccine for Alzheimer's disease research. AADvac 1 is composed of a regulatory peptide 294KDNIKHVPGGGS 305 that drives tau oligomerization conjugated to Aplysia hemocyanin (KLH) and formulated with aluminum hydroxide .
|
- HY-P5413
-
|
|
Peptides
|
Others
|
|
[Lys3]-Bombesin is a biological active peptide. (PET (Positron Emission Tomography) imaging of [Lys3]-bombesin is able to detect gastrin-releasing peptide receptor (GRPR) positive prostate cancer. An immunoconjugate of [Lys3]-bombesin and corresponding monoclonal antibody can specifically induce (CD64)-dependent monocyte and neutrophil-mediated lysis of small cell carcinoma.)
|
- HY-P5425
-
|
|
Peptides
|
Others
|
|
Tetanus Toxin (830–844) is a biological active peptide. (tetanus toxin-derived peptide TT830–844 CD4+ T-cell epitope. This promiscuous CD4+ T-cell epitope can bind to a wide range of HLA–DRB molecules and is thus expected to activate CD4+ T-cell responses in a large part of the human population)
|
- HY-P5453
-
|
|
Peptides
|
Others
|
|
CFP10 (71–85) is a biological active peptide. (CFP1071–85, that elicited IFN-γ production and CTL activity by both CD4+ and CD8+ T cells from persons expressing multiple MHC class II and class I molecules)
|
- HY-P3213
-
- HY-P5259
-
|
|
Peptides
|
Metabolic Disease
|
|
Oligopeptide-6 is a bioactive peptide with moisturizing effect and has been reported used as a cosmetic ingredient .
|
- HY-P5072
-
|
|
Bombesin Receptor
|
Metabolic Disease
|
|
GRP (14-27) (human, porcine, canine) is a bombesin receptor ligand. The specific binding of GRP (14-27) is inhibited by GTP and GDP, whereas GMP was without effect .
|
- HY-P5727
-
|
|
Bacterial
|
Infection
|
|
HR1 is a mastoid protease. HR1 can increase the permeability of human erythrocyte membrane. HR1 can induce cytoplasmic membrane permeation in bacteria and mast cells .
|
- HY-W343750
-
- HY-P5966
-
|
MOG (40-54)
|
Peptides
|
Inflammation/Immunology
|
|
Myelin Oligodendrocyte Glycoprotein (40-54), Rat, Mouse (MOG (40-54)) is a CD8-related self-antigenic epitope of the myelin oligodendrocyte glycoprotein (MOG) protein and is presented in association with H-2Db .
|
- HY-P5969
-
- HY-P5977
-
|
Ste-MPKKKPTPIQLNP-NH₂; ERK Activation Inhibitor Peptide
|
ERK
|
Cancer
|
|
STE-MEK1(13) (Ste-MPKKKPTPIQLNP-NH ) is a cell permeable ERK1/2 inhibitor (IC50: 13-30 μM). STE-MEK1(13) inhibits ERK1/2 phosphorylation .
|
- HY-P10046
-
|
|
Vasopressin Receptor
|
Metabolic Disease
|
|
[Deamino-Pen1,Val4,D-Arg8]-vasopressin (AVP-A) is an arginine-vasopressin (AVP) antagonist. AVP-A can significantly lower plasma aldosterone concentration in rats. AVP-A can be used for the research of the growth and steroidogenic capacity of rat adrenal zona glomerulosa .
|
- HY-P10109A
-
|
hG6PI (325-339) hydrochloride
|
Peptides
|
Inflammation/Immunology
|
|
G6PI 325-339 (human) hydrochloride is an efficient inducer of arthritis in B10.Q mice. G6PI 325-339 (human) hydrochloride primes Th1 and Th17 cells cross-reacted with the murine G6PI protein. G6PI 325-339 (human) hydrochloride induces arthritis model operating through a T and B cell-dependent pathway but without antibody effector mechanisms .
|
- HY-P10109
-
|
|
Peptides
|
Inflammation/Immunology
|
|
G6PI 325-339 (human) is an efficient inducer of arthritis in B10.Q mice. G6PI 325-339 (human) primes Th1 and Th17 cells cross-reacted with the murine G6PI protein. G6PI 325-339 (human) induces arthritis model operating through a T and B cell-dependent pathway but without antibody effector mechanisms .
|
- HY-P10148
-
|
Ac-[Leu28,31]-NPY (24-36)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) is a selective agonist of neuropeptide Y Y2 receptor. N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36) attenuates cardiac vagal action in anaesthetised rats .
|
- HY-P10181
-
|
|
Peptides
|
Others
|
|
Acetyl angiotensinogen (1-14), human is a synthetic peptide and N-terminal acetylated form of Angiotensinogen (1-14), human (HY-P1486) .
|
- HY-P10224
-
|
|
Peptides
|
Cancer
|
|
G7-18NATE is a peptide inhibitor of Grb7. HY-P10224 binds to the Grb7-SH2 domain with micromolar affinity (KD = 18.1 μM). G7-18NATE inhibits cell proliferation, motility, cell invasion and 3D culture formation in several cancer cell lines .
|
- HY-P10310
-
|
|
HIV
|
Infection
|
|
F9170 is an amphipathic peptide with an activity of inactivate HIV-1 virions. F9170 targets the conserved cytoplasmic tail of HIV-1 env and disrupts the integrity of the viral membrane. F9170 is able to cross the blood-brain barrier (BBB) .
|
- HY-P3284
-
|
|
Peptides
|
Cancer
|
|
Mastoparan M tetraacetate is a tetrapeptide amide isolated from the Chinese giant hornet (Vespa mandarinia). The amino acid sequence of Mastoparan M tetraacetate shares some structural homology with Mastoparan X, a wasp venom isolated from the Chinese giant hornet as well .
|
- HY-P10463
-
|
|
Histone Methyltransferase
|
Cancer
|
|
ssK36 is a supersubstrate peptide of the histone methyltransferase (SET) domain protein 2 (SETD2), and ssK36 is designed for the SETD2 protein, a specific PKMT. It is responsible in human cells for adding methyl groups to the 36th lysine residue of histone H3 (H3K36) to form H3K36me3. ssK36 can be methylated by SETD2 at a rate more than 100 times faster than the natural substrate H3K36. ssK36 can be used to study the catalytic mechanism of PKMTs, especially substrate specificity and catalytic efficiency .
|
- HY-P10399
-
|
Mouse KGYY15; KGYY15 peptide
|
TNF Receptor
|
Metabolic Disease
|
|
KGYY15 (Mouse KGYY15) is a CD40 targeting peptide, which weakly inhibits the CD40-CD40L interaction with IC50 of more than 1mM. KGYY15 activates 33% NF-κB pathway at 100 μM .
|
- HY-P10529
-
|
|
Trk Receptor
|
Infection
|
|
Ganglioside GM1-binding peptides p3 is a synthetic peptide that can specifically bind to the pentasaccharide part of GM1 ganglioside. The dynamic transformation of Ganglioside GM1-binding peptides p3 may play an important role in the function of GM1 as a multiple receptor, such as in the classical pathway of cholera toxin infection. Ganglioside GM1-binding peptides p3 can be used to study the interaction between GM1 and its ligands .
|
- HY-P1134
-
|
|
5-HT Receptor
|
Neurological Disease
|
|
Galanin (1-15) (porcine, rat) is the N-terminal 15 amino acids peptide fragment of the neuropeptide galanin. Galanin (1-15) (porcine, rat) interacts with the 5-HT1A receptor in the dorsal hippocampus of the rat brain, reduces the affinity of 5-HT1A receptors, and regulates the serotonin neuronal networks .
|
- HY-P5334A
-
|
|
Peptides
|
Neurological Disease
|
|
AADvac 1 TFA is an active tau peptide vaccine for Alzheimer's disease research. AADvac 1 TFA is composed of a regulatory peptide 294KDNIKHVPGGGS 305 that drives tau oligomerization conjugated to Aplysia hemocyanin (KLH) and formulated with aluminum hydroxide .
|
- HY-P10224A
-
|
|
Peptides
|
Cancer
|
|
G7-18NATE TFA is a peptide inhibitor of Grb7. G7-18NATE TFA binds to the Grb7-SH2 domain with micromolar affinity (Kd = 18.1 μM). G7-18NATE TFA inhibits cell proliferation, motility, cell invasion and 3D culture formation in several cancer cell lines .
|
- HY-P0307
-
|
Penetratin peptide
|
Peptides
|
Cancer
|
|
Antennapedia Peptide (Penetratin peptide) is a 16 amino acid peptide, originally derived from the 60 amino acid long homeodomain of the Drosophila transcription factor Antennapedia and is a member of the family of cell-penetrating peptides.
|
- HY-P0300
-
|
|
Bcl-2 Family
|
Cancer
|
|
Bak BH3 is derived from the BH3 domain of Bak, can antagonize the function of Bcl-xL in cells.
|
- HY-P0307A
-
|
Penetratin peptide TFA
|
Peptides
|
Inflammation/Immunology
Cancer
|
|
Antennapedia Peptide (Penetratin peptide) TFA is a 16 amino acid peptide, originally derived from the 60 amino acid long homeodomain of the Drosophila transcription factor Antennapedia and is a member of the family of cell-penetrating peptides.
|
- HY-P1544
-
- HY-P1592
-
G3-C12
1 Publications Verification
|
Galectin
|
Cancer
|
|
G3-C12 is a galectin-3 binding peptide, with Kd of 88 nM, and shows anticancer activity.
|
- HY-P1578
-
- HY-P1578A
-
- HY-P1735
-
- HY-P1818
-
- HY-P1898
-
- HY-P2155A
-
- HY-P2155
-
- HY-P1382
-
|
|
Ras
|
Cancer
|
|
Rac1 Inhibitor W56 is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
- HY-P1382A
-
|
|
Ras
|
Cancer
|
|
Rac1 Inhibitor W56 TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor W56 TFA inhibits Rac1 interaction with guanine nucleotide exchange factors TrioN, GEF-H1, and Tiam .
|
- HY-P1383
-
|
|
Peptides
|
Others
|
|
Rac1 Inhibitor F56, control peptide is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor F56, control peptide contains a Trp 56 to Phe 56 mutation. Rac1 Inhibitor F56, control peptide has no effect on Rac1 interaction with its guanine nucleotide exchange factors (GEFs) .
|
- HY-P1383A
-
|
|
Peptides
|
Others
|
|
Rac1 Inhibitor F56, control peptide TFA is a peptide containing residues 45-60 of Rac1. Rac1 Inhibitor F56, control peptide TFA contains a Trp 56 to Phe 56 mutation. Rac1 Inhibitor F56, control peptide TFA has no effect on Rac1 interaction with its guanine nucleotide exchange factors (GEFs) .
|
- HY-P2344
-
|
|
HIV Protease
|
Infection
|
|
HIV Protease Substrate 1, a fiuorogenic HIV protease substrate, can be used to study enzymatic activity of HIV protease .
|
- HY-P2344A
-
|
|
HIV Protease
|
Infection
|
|
HIV Protease Substrate 1 TFA, a fiuorogenic HIV protease substrate, can be used to study enzymatic activity of HIV protease .
|
- HY-P1193
-
|
|
Peptides
|
Neurological Disease
|
|
GR 82334 is a potent and specific reversible tachykinin NK1 receptor antagonist . GR 82334 inhibits substance P-induced sensitization by blocking SP NK1 receptors in naked mole-rats .
|
- HY-P2514
-
|
|
Peptides
|
Inflammation/Immunology
|
|
TET 830 modified/T-helper epitope from tetanus toxoid is a modified T-helper epitope from tetanus toxoid. TET 830 modified/T-helper epitope from tetanus toxoid induces T-cells responses and is used as a helper peptide in vaccinations .
|
- HY-P4027
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (554-569) is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) contains a putative n-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
- HY-P4117
-
- HY-P4081
-
|
|
Peptides
|
Others
|
|
Plsl is a cell-penetrating peptide (CPP), with sequence of RVIRVWFQNKRCKDKK. Plsl, belongs to Penetralia family, and origins from Igl-1 homeodomain .
|
- HY-P4703
-
|
|
Peptides
|
Others
|
|
Hydrin 1′ is found in the neurohypophysis of Xenopus. Hydrin 1′ possesses a considerable steroid-releasing activity in Xenopus adrenal gland in vitro .
|
- HY-P4897
-
|
|
Peptides
|
Others
|
|
[Gly9-OH]-Atosiban is the analogue of Atosiban (HY-17572).
|
- HY-P4925
-
|
|
Peptides
|
Others
|
|
Biotinyl-(Arg8)-Vasopressin is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4027A
-
|
|
HCV
|
Infection
|
|
HCV-1 e2 Protein (554-569) TFA is one of the main antigenic regions of HCV envelope 2 (e2) protein. The HCV-1 e2 Protein (554-569) TFA contains a putative N-glycosylation site, which was previously thought to influence the immune recognition of e2 .
|
- HY-P4899
-
|
|
Beta-secretase
|
Neurological Disease
|
|
RE (EDANS) EVNLDAEFK (DABCYL) R is an EDANS and DABCYL double-labeled peptide，serves as a fluorescent substrate for BACE1(Em=360nm，Ex=528nm). RE (EDANS) EVNLDAEFK (DABCYL) R can be used for BACE1 activity measurement and the enzyme activity level is directly proportional to the fluorescence reaction .
|
- HY-P5391
-
|
|
Bacterial
|
Others
|
|
LL-37(17-32) is a biological active peptide. (This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.)
|
- HY-P5401
-
|
|
Peptides
|
Others
|
|
SAP1 is a biological active peptide. (inhibited virus entry into the cells)
|
- HY-P5455
-
|
|
LIM Kinase (LIMK)
|
Others
|
|
S3 Fragment is a biological active peptide. (This peptide contains the unique amino-terminal phosphorylation site of Xenopus ADF/cofilin, the LIM kinase (LIMK) phosphorylation site. LIMK1 is a key regulator of the actin cytoskeleton through its phosphorylation of ADF/cofilin at serine-3 for inactivation. This peptide is a fragment of the S3 peptide containing the serine-3 sequence of ADF/cofilin that has been widely used as an effective competitive inhibitor of LIMK1.)
|
- HY-103287
-
|
|
Bombesin Receptor
|
Cancer
|
|
[D-Phe12,Leu14]-Bombesin is an antagonist of Bombesin Receptor. [D-Phe12,Leu14]-Bombesin can be used for the research of cancer .
|
- HY-P5985
-
mSIRK
1 Publications Verification
|
ERK
|
Others
|
|
mSIRK (G-Protein βγ Binding Peptide) is an cell-permeable activator of ERK1/2, with EC50 of 2.5-5 μM. mSIRK disrupts the interaction between α and βγ subunits and promotes α subunit dissociation without stimulating nucleotide exchange .
|
- HY-P5986
-
|
|
Peptides
|
Others
|
|
mSIRK (L9A) is a cell-permeable, N-myristoylated G-Protein Binding Peptide (mSIRK). mSIRK (L9A) contains a single point mutation (Leu9 to Ala). mSIRK (L9A) cannot enhance ERK1/2 phosphorylation. mSIRK (L9A) can be used as a control peptide .
|
- HY-103282
-
|
|
Bombesin Receptor
|
Others
|
|
[D-Phe12]-Bombesin is a derivative of Bombesin (HY-P0195) and an antagonist for bombesin receptor with Ki of 4.7 μM. [D-Phe12]-Bombesin inhibits the Bombesin (HY-P0195)-induced amylase release, with IC50 of 4 μM .
|
- HY-159046S
-
- HY-P10596
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
Lasioglossin-III is an antimicrobial peptide that can be isolated from the venom of wild bees. Lasioglossin-III has high antibacterial activity against Gram-positive and Gram-negative bacteria, antifungal activity and antitumor activity. Lasioglossin-III has certain cytotoxicity against three cancer cell lines (HeLa S3, CRC SW 480 and CCRF-CEM T) with IC50 values of 4, 18 and 5 μM, respectively .
|
- HY-P10614
-
|
|
Apoptosis
Bcl-2 Family
|
Others
|
|
Bid BH3 peptide is a small peptide derived from Bid protein that can bind and activate the pro-apoptotic proteins Bax and Bak, leading to mitochondrial outer membrane permeabilization (MOMP) and apoptosis. Bid BH3 peptide can be used to study mitochondrial bioenergetics .
|
- HY-P10800
-
|
|
Deubiquitinase
|
Cancer
|
|
T20-M is a lead peptide that shows good potential for binding affinity towards UBE2C .
|
- HY-P10832
-
|
|
Apoptosis
Ras
Raf
MEK
ERK
Caspase
PARP
Bcl-2 Family
|
Cancer
|
|
ATWLPPRAANLLMAAS is a chimeric peptide with anti-angiogenic and potent anti-tumor effects. ATWLPPRAANLLMAAS can inhibit the proliferation, viability, migration, and invasion of human hepatocellular carcinoma cells, and induce apoptosis. .
|
- HY-P0286
-
|
|
Peptides
|
Inflammation/Immunology
|
|
OVA Peptide (323-339) represents a T and B cell epitope of Ovalbumin (Ova), which is important in the generation and development of immediate hypersensitivity responses in BALB/c mice.
|
- HY-P0183
-
- HY-P1051
-
|
Amyloid β-Protein (12-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (Amyloid β-Protein (12-28)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) shows aggregation properties. β-Amyloid (12-28) has the potential for Alzheimer’s disease research .
|
- HY-P1586
-
|
HIV-1 rev Protein (34-50)
|
HIV
|
Infection
|
|
HIV-1 Rev (34-50) is a 17-aa peptide derived from the Rev-responsive element (RRE)-binding domains of Rev in HIV-1, with anti-HIV-1 activity.
|
- HY-P1781
-
|
|
Peptides
|
Cancer
|
|
Peptide C105Y, a synthetic and cell-penetrating peptide based on the amino acid sequence corresponding to residues 359-374 of α1-antitrypsin, enhances gene expression from DNA nanoparticles .
|
- HY-P1811
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Iα52 is a naturally processed peptide encompassed the residues 52-68 of the murine I-Eα chain and may contribute to selection of immature T cells .
|
- HY-P1846
-
|
|
Notch
|
Cancer
|
|
Jagged-1 (188-204) is a fragment of the Jagged-1 (JAG-1) protein with Notch agonist activity. JAG-1 is a Notch ligand highly expressed in cultured and primary multiple myeloma (MM) cells. JAG-1 induces maturation of monocyte-derived human dendritic cells .
|
- HY-P1051A
-
|
Amyloid β-Protein (12-28) (TFA); Amyloid Beta-Peptide (12-28) (human) TFA; β-Amyloid protein fragment(12-28) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (12-28) (TFA) (Amyloid β-Protein (12-28) (TFA)) is a peptide fragment of β-amyloid protein (β1-42). β1-42, a 42 amino acid protein , is the major component of senile plaque cores. β-Amyloid (12-28) (TFA) shows aggregation properties. β-Amyloid (12-28) (TFA) has the potential for Alzheimer’s disease research .
|
- HY-12554A
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
|
Terlipressin diacetate is a vasopressin analogue with potent vasoactive properties. Terlipressin diacetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin diacetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin diacetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-P1333
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A can induce neuronal death, and can be used in the research of neurological disease .
|
- HY-P1333A
-
|
|
Opioid Receptor
Apoptosis
Caspase
Endogenous Metabolite
|
Neurological Disease
|
|
Dynorphin A TFA is an endogenous opioid peptide involved in inhibitory neurotransmission in the central nervous system (CNS). Dynorphin A TFA is a highy potent kappa opioid receptor (KOR) agonist, and is also an agonist for other opioid receptors, such as mu (MOR) and delta (DOR). Dynorphin A TFA can induce neuronal death, and can be used in the research of neurological disease .
|
- HY-P2470
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human PD-L1 inhibitor II is a potent PD-L1 inhibitor with anti-cancer activity .
|
- HY-P3062
-
|
|
Peptides
|
Neurological Disease
|
|
[Tyr11]-Somatostatin is a neuroavtive peptide for proteomics research. Somatostatin is one of many neuroactive substances that influence retinal physiology .
|
- HY-P1849
-
|
scJag-1
|
Peptides
|
Cardiovascular Disease
|
|
JAG-1, scrambled (scJag-1) is a scrambled sequence of JAG-1 (Jagged-1 protein). JAG-1, scrambled has a random sequence of the amino acids that are the same as the active fragment. JAG-1, scrambled is usually used as a negative control .
|
- HY-P4075
-
|
|
Peptides
|
Others
|
|
Antennapedia Leader Peptide (CT) is a cell penetrating peptide that can be used for drug delivery .
|
- HY-P4077
-
|
Penetratin amide
|
Peptides
|
Others
|
|
Antennapedia Peptide, amide is a C-terminal amide cell-penetrating peptide .
|
- HY-P4093
-
- HY-P4767
-
|
|
Peptides
|
Metabolic Disease
|
|
Amylin (1-13) (human) is a fragment and a residues within amyloid cores of Amylin (human IAPP). Amylin is a glucose-regulating hormone, deposits as amyloid fibrils in condition of type II diabetes (T2D). Amylin (1-13) (human) has no effect on firbl formation, as it cannot form fibrils by itself .
|
- HY-P5367
-
|
PMDM6-F
|
Fluorescent Dye
|
Others
|
|
5-FAM-PMDM6 (PMDM6-F) is a biological active peptide. (PMDM6-F is a fluorescent-labeled probe for MDM2-binding assay.)
|
- HY-P5375
-
|
|
Peptides
|
Others
|
|
O-Linked GlcNAc transferase substrate is a biological active peptide. (A peptide substrate of O-linked GlcNAc transferase (OGT), a eukaryotic glycosyltransferase that uses UDP-GlcNAc as a glycosyl donor.)
|
- HY-P5638
-
|
|
Bacterial
|
Infection
|
|
FLGFVGQALNALLGKL-NH2 is an antimicrobial peptide of frog origin. FLGFVGQALNALLGKL-NH2 has activity against Staphylococcus aureus ATCC 29213 (MIC=32 μM) .
|
- HY-P5940
-
|
|
Peptides
|
Neurological Disease
|
|
β-Amyloid precursor protein (96-110), cyclized (human) is an amyloid precursor protein. β-Amyloid precursor protein (96-110), cyclized (human) can be used in study Alzheimer’s disease .
|
- HY-12554B
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
Inflammation/Immunology
Endocrinology
|
|
Terlipressin acetate is a vasopressin analogue with potent vasoactive properties. Terlipressin acetate is a highly selective vasopressin V1 receptor agonist that reduces the splanchnic blood flow and portal pressure and controls acute variceal bleeding. Terlipressin acetate exerts anti-inflammatory and anti-oxidative effects. Terlipressin acetate has the potential for hepatorenal syndrome and norepinephrine-resistant septic shock research .
|
- HY-163427S
-
- HY-P10393
-
|
ERα (295-311)
|
Apoptosis
|
Cancer
|
|
ERα17p (ERα 295-311) is the epitope of the CaM binding site on the estrogen receptor α (ER), which interacts with calmodulin (CaM) in a calcium-dependent manner. ERα17p regulates the migration of cancer cells MCF-7, SK-BR-3, T47D, and MDA-MB-231 through Rho/ROCK and PI3K/Akt signaling pathways. ERα17p inhibits proliferations of breast cancer cells, induces apoptosis, and inhibits tumor growth in mouse models .
|
- HY-P10532
-
|
|
Peptides
|
Others
Inflammation/Immunology
|
|
Myelin basic protein, MBP (68-86) is the portion of the 68th to 86th amino acid residues in the MBP protein sequence. Myelin basic protein, MBP (68-86) can act as an autoantigen, triggering the immune system to attack its own myelin. Myelin basic protein, MBP (68-86) is used as one of the immunogens in the experimental autoimmune encephalomyelitis (EAE) animal model to study immune responses associated with multiple sclerosis (MS) .
|
- HY-P10659
-
|
|
EGFR
|
Cancer
|
|
Self-assembling peptide pY1 is a peptide that assemblies around cancer cells and targets EGFR. When co-cultured with Ovalbumin (OVA), pY1 can effectively block the endocytosis of OVA .
|
- HY-P0084
-
|
SRIF-14; Somatostatin-14
|
Peptides
|
Cardiovascular Disease
Neurological Disease
|
|
Cyclic somatostatin (SRIF-14) is a growth hormone-release inhibiting factor used in the research of severe, acute hemorrhages of gastroduodenal ulcers. Cyclic somatostatin is a neuropeptide co-stored with acetylcholine in the cardiac parasympathetic innervation, exerts influences directly on contraction of ventricular cardiomyocytes. Cyclic somatostatin inhibits the contractile response of isoprenaline with an IC50 value of 13 nM. Cyclic somatostatin can be used for the research of cardiovascular disease .
|
- HY-12523
-
|
|
Peptides
|
Others
|
|
Peptide M is a synthetic amino acid (18 amino acids in length which correspond to the amino acid positions 303-322 of bovine S-antigen: DTNLASSTIIKEGIDKTV), is capable of inducing experimental autoimmune uveitis in monkeys and Hartley guinea pigs as well as Lewis rats .
|
- HY-P1603
-
|
Adrenocorticotropic Hormone (22-39)
|
Peptides
|
Metabolic Disease
|
|
ACTH (22-39) is an adrenocorticotropic hormone (ACTH) fragment. ACTH (22-39) is the 22-39 sequence of ACTH.
|
- HY-P1777
-
|
Insulin-like Growth Factor I (24-41)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) is amino acids 24 to 41 fragment of IGF-I. IGF-I, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I is partly responsible for systemic growth hormone (GH) activities. IGF-I has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) regulates somatic growth and behavioral development .
|
- HY-P1212
-
|
CST-14 (mouse, rat)
|
Somatostatin Receptor
|
Neurological Disease
|
|
Cortistatin 14, mouse, rat (CST-14, human, rat), a neuropeptide with neuronal depressant and sleep modulating properties, can bind to all five cloned somatostatin receptors (SSTRs) and ghrelin receptor to exert its biological activities and co-exists with GABA within the cortex and hippocampus .
|
- HY-P1872
-
|
|
Bacterial
|
Infection
|
|
OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa .
|
- HY-P1777A
-
|
Insulin-like Growth Factor I (24-41) (TFA)
|
IGF-1R
|
Metabolic Disease
Inflammation/Immunology
|
|
IGF-I (24-41) (Insulin-like Growth Factor I (24-41)) TFA is amino acids 24 to 41 fragment of IGF-I. IGF-I TFA, a 70 aa polypeptide hormone, is a trophic factor for both neurons and glial cells. IGF-I TFA is partly responsible for systemic growth hormone (GH) activities. IGF-I TFA has anabolic, antioxidant, anti-inflammatory and cytoprotective actions. IGF-I (24-41) TFA regulates somatic growth and behavioral development .
|
- HY-P1341
-
|
Orexin A (17-33) (human, mouse, rat, bovine)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
OXA(17-33) is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
- HY-P1341A
-
|
Orexin A (17-33) (human, mouse, rat, bovine) TFA
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
OXA(17-33) TFA is a potent and selective orexin-1 receptor (OX1) agonist. OXA(17-33) TFA shows a ∼23-fold selectivity for the OX1 (EC50=8.29 nM) over OX2 (187 nM) .
|
- HY-P1111A
-
|
|
Src
Interleukin Related
|
Inflammation/Immunology
|
|
Lyn peptide inhibitor TFA is a potent and cell-permeable inhibitor of Lyn-coupled IL-5 receptor signaling pathway, while keeping other signals intact. Lyn peptide inhibitor TFA blocks Lyn activation and inhibits the binding of Lyn tyrosine kinase to βc subunit of IL-3/GM-CSF/IL-5 receptors. Lyn peptide inhibitor TFA can be used for study of asthma, allergic, and other eosinophilic disorders .
|
- HY-P1118
-
- HY-P1118A
-
- HY-P2474
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human PD-L1 inhibitor I is a hPD-1 peptide ligand, with a KD of 3.39 μM. Human PD-L1 inhibitor I may disturb the binding of hPD-L1 to hPD-1 .
|
- HY-P2492
-
|
|
Angiotensin Receptor
|
Metabolic Disease
|
|
Renin FRET Substrate I is a substrate of human renin. Renin FRET Substrate I is designed to incorporate the renin cleavage site that occurs in the N-terminal peptide of human angiotensinogen .
|
- HY-P2545
-
- HY-P2529
-
|
|
Peptides
|
Others
|
|
Penetratin is a peptide derived from the amphiphilic Drosophila Antennapedia homeodomain .
|
- HY-P4397
-
|
|
Oxytocin Receptor
|
Endocrinology
|
|
(d(CH2)51,Tyr(Me)2,Thr4,Orn8,des-Gly-NH29)-Vasotocin, an oxytocin receptor antagonist, abolishes oxytocin-enhanced inhibitory postsynaptic currents in CA1 pyramidal neurons .
|
- HY-P5295
-
|
|
Fluorescent Dye
|
Others
|
|
Cy3-Ova (323-339) is an Cy3 labled OVA Peptide (323-339) (HY-P0286). Cy3 is a fluorescent dye belonging to the Cyanine family and is a fluorescent light product of Cy5. Cyanine is commonly used in fluorescence microscopy, cell imaging, and molecular biology experiments. OVA Peptide (323-339) represents the T and B cell epitopes of ovalbumin (OVA). OVA Peptide (323-339) has limited immunogenic efficacy in activating OVA-sensitized and attacked mouse spleen cells .
|
- HY-P0286F
-
|
|
Peptides
|
Others
|
|
Biotin-OVA (323-339) is a biological active peptide. (Biotin labeled HY-P0286)
|
- HY-P0300F
-
- HY-P5885
-
|
|
PKC
|
Others
|
|
PKCη pseudosubstrate inhibitor,myristoylated is cell permeable and can be used to study the mechanism of action of PKCη .
|
- HY-P2442
-
|
|
Bacterial
|
Others
|
|
Bombolitin V is a potent antimicrobial peptide with an ED 50 value of 2 micrograms/ml in causing mast cell degranulation .
|
- HY-P5016
-
|
|
Antibiotic
Bacterial
Fungal
|
Infection
Cancer
|
|
CRAMP-18 (mouse) is an antibiotic peptide without hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has the potential to study antifungal, antibacterial and antitumor .
|
- HY-P5654
-
|
|
Bacterial
|
Infection
|
|
Bombolitin IV is an antimicrobial peptide derived from bumblebee venom. Bombolitin IV can lysate erythrocyte and liposome .
|
- HY-P10252
-
|
|
HIV
|
Inflammation/Immunology
|
|
HIV gp120 421-438 is HIV antigen fragments, that conjugates with keyhole limpet hemocyanin (KLH) and generates specific anti-HIV antibody .
|
- HY-P10283
-
|
|
GHSR
STAT
|
Endocrinology
|
|
S1H, a mimetic of hGH, is a human growth hormone receptor (hGHR) antagonist. S1H inhibits the interaction of hGH with hGHR. S1H inhibits phosphorylation of STAT5 in cells co-treated with hGH .
|
- HY-P2191
-
|
|
Kisspeptin Receptor
|
Endocrinology
|
|
KISS1-305, the Metastin/Kisspeptin analog, is a prototype peptide and a chemical probe. KISS1-305 has suboptimal KISS1R agonistic activity, and resists plasma protease degradation .
|
- HY-P10803
-
|
|
SARS-CoV
|
Infection
|
|
FLDKFNHEAEDLFYQSSL is an 18-residue peptide that binds to SARS-CoV-2 receptor-binding domain (RBD). FLDKFNHEAEDLFYQSSL inhibits the entry of SARS-Cov-2. FLDKFNHEAEDLFYQSSL also interacts with binding residues (Leu455, Phe456, Ala475 and Gln493) .
|
- HY-P1246
-
- HY-P1588
-
- HY-P1600
-
|
|
Peptides
|
Others
|
|
Tyr-Somatostatin-14 is a customized peptide that adds a Tyrosine amino acid to Somatostatin-14.
|
- HY-P1932A
-
- HY-P2243
-
- HY-P4138
-
|
|
Fluorescent Dye
|
Cancer
|
|
Antennapedia Peptide FAM-labeled is a fluorophore labeled peptide. Antennapedia Peptide FAM-labeled also can be used for the research of cancer as a molecular probe .
|
- HY-P4135
-
|
|
Peptides
|
Others
|
|
FITC-LC-Antennapedia Peptide is a FITC labeled Antennapedia Peptide (HY-P0307). Antennapedia Peptide is a cellular-membrane permeable peptides (CPP). FITC-LC-Antennapedia Peptide has good penetration in 3T3 cell line, which was rapidly accumulated into nuclei .
|
- HY-P4151
-
- HY-P4152
-
- HY-P4351
-
|
|
HIV
|
Others
|
|
HIV-1 gag Protein p24 (194-210) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4562
-
|
|
Peptides
|
Others
|
|
(D-Phe7)-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4792
-
- HY-P4904
-
|
Neuropeptide NPVF (rat)
|
Peptides
|
Neurological Disease
|
|
RFRP-3 (rat) is a neuropeptide. RFRP-3 (rat) inhibits gonadotropin secretion, causing a marked increase in ghrelin mRNA and plasma growth hormone levels .
|
- HY-P4942
-
|
|
Peptides
|
Others
|
|
Biotinyl-Somatostatin-14 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5121
-
|
|
Peptides
|
Cardiovascular Disease
|
|
γ-Fibrinogen377-395 is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation .
|
- HY-P5121A
-
|
|
Peptides
|
Cardiovascular Disease
|
|
γ-Fibrinogen377-395 TFA is a fibrinogen-derived inhibitory peptide, as well as fibrinogen epitope. γ-Fibrinogen377-395 TFA blocks microglia activation and inhibits fibrin-Mac-1 interactions in vitro, and suppresses experimental autoimmune encephalomyelitis (EAE) in mice in vivo. γ-Fibrinogen377-395 TFA can be used for research in multiple sclerosis (MS), and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation .
|
- HY-P5276
-
|
|
PD-1/PD-L1
|
Cancer
|
|
Human membrane-bound PD-L1 polypeptide can be used as an antigen to induce PD-L1 antibody production .
|
- HY-P0286F1
-
- HY-P5351
-
|
|
Peptides
|
Others
|
|
Hyaluronan-binding peptide, biotin labeled is a biological active peptide. (This peptide is a hyaluronan-binding peptide biotinylated through a C-terminal GGGSK linker. Hyaluronan (HA) is a nonsulfated glycosaminoglycan expressed in the extracellular matrix and on cell surfaces. HA plays a role in fertilization, embryonic development, wound healing, angiogenesis, leukocyte trafficking to inflamed tissues, and cancer metastasis. This peptide has been shown to block HA binding to CD44 receptors and inhibit T cell proliferation.)
|
- HY-P5495
-
|
|
Peptides
|
Others
|
|
Uroguanylin-15 (Rat) is a biological active peptide. (Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.)
|
- HY-P5675
-
|
|
Bacterial
|
Infection
|
|
Bombinin H7 is an antimicrobial peptide derived from skin secretions of Bombina. Bombinin H7 is active against Bacillus megaterium Bm11 with a lethal concentration of 25.2 μM .
|
- HY-P10034
-
|
Pss-PT
|
Peptides
|
Endocrinology
|
|
Pheromonotropin (Pseudaletia separata) (Pss-PT) is an armyworm (Pseudaletia separata) pheromone with the C-terminal pentapeptide FXPRL-amide. Pheromonotropin (Pseudaletia separata) belongs to the PK/PBAN family and stimulates sex pheromone biosynthesis in moths, mediating feeding (intestinal muscle contraction), development (embryonic diapause, pupal diapause, and pupation), and defense against natural enemy insects wait .
|
- HY-P10396
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Elf18 is the bacterial N-terminal fragment of Elongation Factor Thermus (EF-Tu). Elf18 is recognized by pattern recognition receptors (PRRs) as a pathogen-associated molecular pattern (PAMP), and thus induces immune response in Arabidopsis .
|
- HY-P10562
-
|
|
TMV
|
Others
|
|
BMV Gag-(7−25) is an arginine-rich peptide with cell-penetrating ability. BMV Gag-(7−25) can be used in drug delivery and gene therapy research .
|
- HY-P10515
-
|
|
Bacterial
Fungal
|
Infection
Cancer
|
|
AcrAP2 is an antimicrobial peptide present in the venom of the Arabian scorpion (Androctonus crassicauda). AcrAP2 is inhibitory against Gram-positive bacteria and yeast but is essentially inactive against Gram-negative bacteria. A cation-enhanced AcrAP2 analog (AcrAP2a) exhibits significant antiproliferative effects at low concentrations against certain human cancer cell lines. AcrAP2 can be used in antibacterial and anti-tumor research .
|
- HY-P0286F1A
-
|
|
Peptides
|
Others
|
|
FITC-OVA (323-339) TFA is a biological active peptide . (FITC labeled HY-P0286)
|
- HY-P10780
-
|
Neuropeptide NPVF (mouse)
|
Neuropeptide FF Receptor
Apoptosis
MDM-2/p53
PERK
|
Endocrinology
|
|
RFRP-3 (mouse) is a functional ortholog of avian gonadotropin inhibitory hormone (GnIH), binding to GPR147. RFRP-3 (mouse) reduces Progesterone synthesis by inhibiting FSHR and key enzymes involved in steroidogenesis (P450scc, 3β-HSD, StAR). RFRP-3 (mouse) induces Apoptosis (increase of p53). RFRP-3 (mouse) also suppresses the ERK signaling pathway. RFRP-3 (mouse) can be used for research of follicular development .
|
- HY-P1479
-
|
|
Autophagy
CaMK
|
Neurological Disease
|
|
Calmodulin-Dependent Protein Kinase II (290-309) is a potent CaMK antagonist with an IC50 of 52 nM for inhibition of Ca2+/calmodulin-dependent protein kinase II .
|
- HY-P1861
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Interphotoreceptor Retinoid Binding Protein Fragment (IRBP), a 20-residue peptide and a major pathogenic epitope, is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP 161–180), which can induce posterior uveitis (EAU) .
|
- HY-P1875
-
- HY-P1875A
-
- HY-P1389A
-
|
|
Peptides
|
Neurological Disease
|
|
Neuropeptide S human TFA, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human TFA can be used for Alzheimer's disease (AD) research .
|
- HY-P2299
-
|
|
HPV
|
Cancer
|
|
Protein E7(43-62) is an E7-derived peptide with anti-tumor effects (short peptide spanning the 43th to 62th amino acid residues in the E7 protein) .
|
- HY-P1389
-
|
|
Peptides
|
Neurological Disease
|
|
Neuropeptide S human, a neuropeptide, is a potent cognate neuropeptide S receptor (NPSR) agonist. Neuropeptide S human can be used for Alzheimer's disease (AD) research .
|
- HY-P0222
-
|
|
PKA
|
Others
|
|
PKI(5-24) is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
- HY-P0222A
-
|
|
PKA
|
Others
|
|
PKI(5-24) TFA is a potent, competitive, and synthetic peptide inhibitor of PKA (cAMP-dependent protein kinase), with a Ki of 2.3 nM. PKI(5-24) TFA corresponds to residues 5-24 in the naturally occurring heat-stable protein kinase inhibitor .
|
- HY-P1039
-
|
PHCVPRDLSWLDLEANMCLP
|
Raf
|
Cancer
|
|
R18 is a peptide antagonists of 14-3-3, with a KD of 70-90 nM. R18 efficiently blocks the binding of 14-3-3 to the kinase Raf-1, a physiological ligand of 14-3-3, and effectively abolished the protective role of 14-3-3 against phosphatase-induced inactivation of Raf-1 .
|
- HY-P1039A
-
|
PHCVPRDLSWLDLEANMCLP TFA
|
Raf
|
Cancer
|
|
R18 TFA is a peptide antagonists of 14-3-3, with a KD of 70-90 nM. R18 efficiently blocks the binding of 14-3-3 to the kinase Raf-1, a physiological ligand of 14-3-3, and effectively abolished the protective role of 14-3-3 against phosphatase-induced inactivation of Raf-1 .
|
- HY-P2466
-
|
|
Apoptosis
|
Cancer
|
|
Bax BH3 peptide (55-74), wild type is a 20-amino acid Bax BH3 peptide (Bax 1) capable of inducing apoptosis in a variety of cell line models .
|
- HY-P3066
-
|
d(CH2)5Tyr(Et)VAVP
|
Vasopressin Receptor
|
Metabolic Disease
|
|
SKF 100398 (d(CH2)5Tyr(Et)VAVP), an arginine vasopressin (AVP) analogue, is a specific antagonist of the antidiuretic effect of exogenous and endogenous AVP .
|
- HY-P3678
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Neuropeptide Y (18-36) (porcine) is a competitive neuropeptide Y (NPY) cardiac receptor antagonist. Neuropeptide Y (18-36) (porcine) inhibits the binding of I-NPY to cardiac ventricular membranes in a concentration-dependent manner with an IC50 value of 158 nM and an Ki value of 140 nM. Neuropeptide Y (18-36) (porcine) can be used for the research of congestive heart failure .
|
- HY-P4106
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
- HY-P4997
-
|
|
Peptides
|
Others
|
|
Tyr-Uroguanylin (mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1861A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
Interphotoreceptor Retinoid Binding Protein Fragment (IRBP) TFA, a 20-residue peptide and a major pathogenic epitope, is present in the first homologous repeat of the interphotoreceptor retinoid binding protein peptide (IRBP 161–180), which can induce posterior uveitis (EAU) .
|
- HY-P4106A
-
|
|
Amino Acid Derivatives
|
Neurological Disease
|
|
Tat-GluR23Y, scrambled TFA is the scrambled peptide of Tat-GluR23Y (HY-P2259). Tat-GluR23Y is a synthetic peptide containing tyrosine residues that inhibit AMPAR endocytosis and is effective in the research of long-term depression (LTD) .
|
- HY-P5305A
-
|
|
GABA Receptor
|
Metabolic Disease
|
|
GAD65(247-266) epitope TFA is the T cell epitopes of islet antigens，binding to I-A g7 (type I diabetes-associated molecule) competitively with poor affinity. GAD65 refers to Glutamic Acid Decarboxylase 65，involved in the conversion of glutamate to gamma-aminobutyric acid (GABA) .
|
- HY-P1527
-
|
|
Bcl-2 Family
|
Others
|
|
Bim BH3 is a biological active peptide. (This Bim peptide belongs to the pro-apoptotic Bcl-2 family of proteins.)
|
- HY-P5325
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99) is a biological active peptide. (BID is a pro-apoptotic member of the 'BH3-only' (BOPS) subset of the BCL-2 family of proteins that constitute a critical control point in apoptosis. Bid is the first of the BOPs reported to bind and activate Bcl-2, Bax, and Bak. Bid serves as a death-inducing ligand that moves from the cytosol to the mitochondrial membrane to inactivate Bcl-2 or to activate Bax.Pyroglutamyl (pGlu) peptides may spontaneously form when either Glutamine (Q) or Glutamic acid (E) is located at the sequence N-terminus. The conversion of Q or E to pGlu is a natural occurrence and in general it is believed that the hydrophobic γ-lactam ring of pGlu may play a role in peptide stability against gastrointestinal proteases. Pyroglutamyl peptides are therefore considered a normal subset of such peptides and are included as part of the peptide purity during HPLC analysis.)
|
- HY-P5330
-
- HY-P5395
-
|
|
HIV
|
Others
|
|
TAT-GluR23A Fusion Peptide is a biological active peptide. (This is the GluR23A sequence, a control inactive peptide used as a mutant counterpart to glutamate receptor endocytosis inhibitor (GluR23Y), connected to an 11 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). GluR23A is derived from GluR23Y amino acids 869 to 877, with Ala substituted for Tyr, and thus lacking essential phosphorylation sites.Control peptide of HY-P2259)
|
- HY-P5505
-
|
|
Arenavirus
|
Others
|
|
LCMV-derived p13 epitope is a biological active peptide. (An H-2Db restricted epitope, this peptide is amino acids 61 to 80 fragment of the lymphocytic choriomeningitis virus (LCMV) pre-glycoprotein polyprotein GP complex. LCMV has been routinely used for the study of adaptive immune responses to viral infection.)
|
- HY-P4799
-
- HY-P5545
-
|
|
Bacterial
|
Infection
|
|
Lynronne-1 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including MDR strains (MIC: 8-32 μg/mL for methicillin-resistant MRSA strains). Lynronne-1 reduces the bacterial load in MRSA infected wound murine model. Lynronne-1 is also effective against P. aeruginosa infection .
|
- HY-P5918
-
|
NAX-5055
|
Peptides
|
Neurological Disease
|
|
Galanin-B2 (NAX-5055) has activity in the epilepsy model. Galanin-B2 can penetrate the blood-brain-barrier .
|
- HY-P10278
-
|
|
Peptides
|
Endocrinology
|
|
Anantin binds competitively to the receptor of atrial natriuretic factor (ANF) from bovine adrenal cortex (Kd = 0.6 μM) and acts as natriuretic peptide receptor A antagonist .
|
- HY-P10445
-
|
|
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4 that disrupts the BRD4/JMJD6 interaction. BRD4/JMJD6 is a protein complex that is critical for oncogene expression and breast cancer, and TAT-PiET inhibits BRD4/JMJD6 target gene expression and breast cancer cell growth. TAT-PiET also resists endocrine resistance in ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
- HY-P10437
-
|
human α1-AT(353-372)
|
HIV
|
Infection
|
|
VIRIP (human α1-AT(353-372)) is a HIV-1 inhibitor. VIRIP blocks the entry of HIV-1 by interacting with gp41 fusion peptide. VIRIP can be used for virus research .
|
- HY-P10458
-
|
Human/rat 5-LO (130-149)
|
Lipoxygenase
|
Others
|
|
5-Lipoxygenase blocking peptide (Human/rat 5-LO 130-149) is a specific sequence fragment of 5-lipoxygenase (5-LOX), which can be utilized to prepare an antibody against 5-LOX .
|
- HY-P10503
-
|
|
Peptides
|
Cardiovascular Disease
Others
Inflammation/Immunology
|
|
S2-16 is a synthetic peptide from the S2 region of cardiac myosin. S2-16 is a cryptic epitope that induces myocarditis in Lewis rats. A cryptic epitope is an epitope that is not recognized by antibodies or T cells after the animal is immunized with the intact antigen. S2-16 can be used to study the mechanism of autoimmune myocarditis .
|
- HY-P10625
-
|
|
Apoptosis
|
Metabolic Disease
Cancer
|
|
SHLP-6 is a mitochondrial-derived peptide, a biologically active microprotein encoded by the 16S ribosomal RNA (MT-RNR2) gene. SHLP6 increases apoptosis in insulinoma cells NIT1 and human prostate cancer cell 22Rv1. SHLP6 can be used in the study of diabetes and cancer .
|
- HY-P6312
-
|
|
Bacterial
|
Infection
|
|
ESAT6 Epitope is a known CD4+ T cell epitope in early secretory antigen target gene 6 (ESAT6) that binds to major histocompatibility complex MHC class I with nanometer affinity (IC50=180 nM). ESAT6 Epitope can be used to enhance BCG-induced anti-Mycobacterium tuberculosis cellular immunity .
|
- HY-P10856
-
|
|
ATP-binding Cassette (ABC) transporter
|
Cancer
|
|
CPI1 is a potent and highly specific multidrug resistance protein 1 (MRP1) inhibitor. CPI1 inhibits MRP1 (Ki: 100 nM) with nanomolar potency but shows minimal inhibition of P-glycoprotein (Pgp). CPI1 and LTC4 compete to bind to the same site of MRP1, inhibiting ATP hydrolysis and substrate transport. CPI1 can be used to study drug delivery and chemotherapy resistance in cancer .
|
- HY-15664
-
- HY-P0262
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
Endocrinology
|
|
Galantide, a non-specific galanin receptor antagonist, is a peptide consisting of fragments of galanin and substance P. Galantide recognizes two classes of galanin binding sites (KD<0.1 nM and ~6 nM) in the rat hypothalamus. Galantide dose dependently (IC50=1.0 nM) antagonizes the galanin-mediated inhibition of the glucose-induced insulin secretion from mouse pancreatic islets. Galantide appears to bind to a single population of SP receptors (KD~40 nM) .
|
- HY-P0305
-
|
Prion protein (106-126)
|
Peptides
|
Infection
|
|
PrP (106-126) is a peptide corresponding to the prion protein (PrP) amyloidogenic region, and its biochemical properties resemble the infectious form of prion protein.
|
- HY-P1025
-
- HY-P1530
-
|
|
Peptides
|
Neurological Disease
|
|
Prolactin Releasing Peptide (12-31), human is a fragment of the prolactin releasing peptide (PrRP). Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin.
|
- HY-P1831
-
|
ProAM N20, Human; PAMP-20, human
|
nAChR
|
Neurological Disease
|
|
Proadrenomedullin (1-20), human is a potent hypotensive and catecholamine release–inhibitory peptide released from chromaffin cells with an IC50 of ~350 nM for catecholamine secretion in PC12 pheochromocytoma cells, acting in a noncompetitive manner specifically at the nicotinic cholinergic receptor .
|
- HY-P1240A
-
|
MOG (35-55) TFA
|
Peptides
|
Neurological Disease
Inflammation/Immunology
|
|
Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat (MOG (35-55)) TFA is a minor component of CNS myelin. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA has encephalitogenic activity and induces T cell proliferative. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA induces Th1 cytokine response as well as relatively high levels of IgG antibodies. Myelin Oligodendrocyte Glycoprotein Peptide (35-55), mouse, rat TFA produces a relapsing-remitting neurological disease with extensive plaque-like demyelination .
|
- HY-P1929
-
|
|
Thrombin
|
Cardiovascular Disease
|
|
Bivalirudin, a peptide anticoagulant, is a direct thrombin inhibitor for anticoagulation in the setting of invasive cardiology, particularly percutaneous coronary intervention .
|
- HY-P2343
-
|
|
Apoptosis
|
Cancer
|
|
BH3 hydrochloride, a BBB penetrated peptide, provoke apoptosis either by direct activation of pro-apoptotic Bax/Bak or by neutralizing anti-apoptotic Bcl-2 proteins (Bcl-2, Bcl-XL, Bcl-w, Mcl-1 and A-1) via their BH3 domian .
|
- HY-P1131A
-
|
|
Neuropeptide Y Receptor
|
Cardiovascular Disease
|
|
M617 TFA is a selective galanin receptor 1 (GAL1) agonist, with Kis of 0.23 and 5.71 nM for GAL1 and GAL2, respectively. M617 TFA, acting through its central GAL1, can promote GLUT4 expression and enhance GLUT4 content in the cardiac muscle of type 2 diabetic rats .
|
- HY-P3464
-
- HY-P3789
-
|
|
Peptides
|
Metabolic Disease
|
|
Prolactin-Releasing Peptide (12-31), rat is a fragment of the prolactin releasing peptide (PrRP). Prolactin-Releasing Peptide (12-31), rat shows high affinity for GPR10 receptors. Prolactin-Releasing Peptide (12-31), stimulates calcium mobilization in CHOK1 cells transfected with the PrRP receptor .
|
- HY-P0262A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Metabolic Disease
|
|
Galantide TFA is a reversible and non-specific galanin (GAL) receptor antagonist. Galantide TFA dose-dependently shows antagonism to galanin-induced K + conductance with an IC50 value of 4 nM. Galantide TFA can be used for the research of neurological disease and hormone metabolism research .
|
- HY-P4842
-
|
|
Peptides
|
Others
|
|
pTH (28-48) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4814
-
|
Rat PAMP
|
Peptides
|
Others
|
|
Proadrenomedullin (1-20, rat) (Rat PAMP) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4746
-
|
|
Bacterial
|
Infection
|
|
LL-37 FKR is the C-terminal fragment of LL-37. LL-37 FKR plays an important role in antibacterial performance .
|
- HY-P4747
-
|
|
Antibiotic
Bacterial
|
Infection
|
|
LL-37 GKE is an active domain of LL-37. LL-37 GKE has antibacterial activity and has potential applications in antibiotics .
|
- HY-P4749
-
|
|
Peptides
|
Neurological Disease
|
|
Prion Protein (106-126) (human) (scrambled) is a scrambled sequence of Prion Protein (106-126). Prion Protein (106-126) (human) (scrambled) with a random sequence of the amino acids that are the same as the active fragment. Prion Protein (106-126) (human) (scrambled) usually used as a negative control .
|
- HY-P5744
-
|
|
Peptides
|
Inflammation/Immunology
|
|
SPPHPSPAFSPAFDNLYYWDQ is a multi-epitope class II rat HER2/neu peptide. SPPHPSPAFSPAFDNLYYWDQ can be used for the research class II HER2-DC1 vaccine studies .
|
- HY-P5744A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
SPPHPSPAFSPAFDNLYYWDQ TFA is a multi-epitope class II rat HER2/neu peptide. SPPHPSPAFSPAFDNLYYWDQ TFA can be used for the research class II HER2-DC1 vaccine studies .
|
- HY-P5823
-
|
|
nAChR
|
Neurological Disease
|
|
Azemiopsin is a potent nicotinic acetylcholine receptor (nAChR) inhibitor with IC50s of 0.18 μM and 22 μM against T. californica nAChR and human α7 nAChR, respectively. Azemiopsin blocks acetylcholine-induced currents in Xenopus oocytes heterologously expressing human muscle-type nAChR .
|
- HY-P5876
-
|
ProADM N20(bovine, porcine); PAMP-20(bovine, porcine)
|
nAChR
|
Neurological Disease
|
|
Proadrenomedullin (N-20) (ProADM N20) (bovine, porcine) is a potent and noncompetitive hypotensive and catecholamine release-inhibitory peptide released from chromaffin cells. Proadrenomedullin (N-20) (bovine, porcine) inhibits catecholamine secretion with an IC50 of 350 nM in PC12 pheochromocytoma cells. Proadrenomedullin (N-20) (bovine, porcine) also blocks (EC50≈270 nM) nicotinic cholinergic agonist desensitization of catecholamine release, as well as desensitization of nicotinic signal transduction ( 22Na + uptake) .
|
- HY-P5077
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
Guanylin (mouse, rat), a petide, is composed of 15 amino acids. Guanylin (mouse, rat) is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) can be used for the research of diarrhea .
|
- HY-P5546
-
|
|
Bacterial
|
Infection
|
|
Lynronne-2 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-256 μg/mL for methicillin-resistant MRSA strains). Lynronne-2 is also effective against P. aeruginosa infection
|
- HY-P5547
-
|
|
Bacterial
|
Infection
|
|
Lynronne-3 is an antimicrobial peptide. Lynronne-1 is active against Gram-positive bacterials, including
MDR strains (MIC: 32-128 μg/mL for methicillin-resistant MRSA strains). Lynronne-3 is also effective against P. aeruginosa infection
|
- HY-P4984
-
|
|
Biochemical Assay Reagents
|
Inflammation/Immunology
Cancer
|
|
Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) is a T cell proliferation activator. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) promotes the in vitro proliferation of human peripheral blood mononuclear cells (PBMC) in a dose-dependent manner. Toxic Shock Syndrome Toxin-1 (TSST-1) (58-78) can be used in research on inflammatory and immunity, as well as cancer .
|
- HY-P5011
-
- HY-P5616
-
|
|
Bacterial
|
Infection
|
|
Maximin H1 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H1 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 9, 4.5, 9, 4.5 μg/ml, respectively .
|
- HY-P5619
-
|
|
Bacterial
|
Infection
|
|
Maximin H3 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H3 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 20, 10, 20, 5 μg/ml, respectively .
|
- HY-P5661
-
|
|
Peptides
|
Infection
|
|
Maximin H7 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5684
-
|
|
Bacterial
|
Infection
|
|
Maximin H39 is an antimicrobial peptide. MaximinH39 has antibacterial activity against C. albicans, S. aureus, B. subtilis (MIC: 9.4, 9.4, 18.8 μg/mL). Maximin H39 has hemolytic activities against human and rabbit red cells .
|
- HY-P10188
-
|
|
Peptides
|
Cardiovascular Disease
|
|
apoB (4372-4392) is a potent lipoprotein(a) assembly inhibitor, with an IC50 of 40 μM. apoB (4372-4392) can noncovalently bind to apolipoprotein(a) with high affinity .
|
- HY-P10153
-
|
|
Peptides
|
Others
|
|
gH625 is a cell-penetrating viral peptide which is a part of glycoprotein H of Herpes simplex virus type I. gH625 is able to cross the cell membrane and to transport many conjugated cargoes into the cytosol. gH625 is permeable to the blood-brain barrier (BBB) and can enter the rat brain in vivo without toxic effects. gH625 can be used for siRNA delivery research .
|
- HY-P1025A
-
- HY-P10228
-
|
|
Fungal
Bacterial
|
Infection
|
|
S-Thanatin is an insect antimicrobial peptide with potent broad-spectrum antibacterial activity. S-Thanatin can inhibit the activity of Gram-negative bacteria, Gram-positive bacteria, and fungi, without cytotoxicity. The antibacterial activity of S-Thanatin is not affected by PH value, but monovalent cations (Na +/K +) can reduce its antibacterial activity against Gram-negative bacteria in a dose-dependent manner .
|
- HY-P10249
-
|
|
Peptides
|
Inflammation/Immunology
|
|
HIV gp120 254-274 is a conserved fragment in envelope glycoprotein gp120 of human immunodeficiency virus (HIV), and exhibits immunosilent activity .
|
- HY-P10413
-
|
|
Androgen Receptor
|
Metabolic Disease
Endocrinology
|
|
SHBG 141-161 is a GPRC6A receptor agonist. SHBG 141-161 mimics the action of GPRC6A endogenous agonist uncarboxylated osteocalcin by binding to GPRC6A and promoting downstream signaling to increase testosterone and insulin secretion. SHBG 141-161 also reduces the affinity of GPRC6A to GDP protein by binding to the outer cell domain of GPRC6A thus affecting the dynamics of signal transduction. SHBG 141-161 can be used to study GPRC6A in energy metabolism and endocrine regulation .
|
- HY-P5077A
-
|
|
Guanylate Cyclase
|
Metabolic Disease
|
|
Guanylin (mouse, rat) TFA, a petide, is composed of 15 amino acids. Guanylin (mouse, rat) TFA is an activator of intestinal guanylate cyclase. Guanylin (mouse, rat) TFA can be used for the research of diarrhea .
|
- HY-P10636
-
|
|
LRRK2
|
Others
|
|
Nictide is a peptide substrate of LRRK2 (leucine-rich repeat protein kinase-2). Nictide can be phosphorylated by the activated LRRK2[G2019S] with a Km of 10 μM .
|
- HY-P1037
-
|
|
Motilin Receptor
|
Others
|
|
Motilin (26-47), human, porcine is an endogenous motilin receptor ligand with Ki and EC50 of 2.3 nM and 0.3 nM in a Chinese hamster ovary cell line.
|
- HY-P1476
-
|
CLIP (human)
|
Peptides
|
Metabolic Disease
|
|
Adrenocorticotropic Hormone (ACTH) (18-39), human is a corticotropinlike intermediate lobe peptide, which is produced in the melanotrophs of the intermediate lobe of the pituitary.
|
- HY-P1541
-
|
Motilin (canine)
|
Motilin Receptor
|
Metabolic Disease
|
|
Motilin, canine is a 22-amino acid peptide. Motilin is a potent agonist for gastrointestinal smooth muscle contraction.
|
- HY-P1568
-
|
Flagellin 22
|
Bacterial
|
Infection
|
|
Flagelin 22 (Flagellin 22), a fragment of bacterial flagellin, is an effective elicitor in both plants and algae .
|
- HY-P1476A
-
|
CLIP (human) (TFA)
|
Peptides
|
Metabolic Disease
|
|
Adrenocorticotropic Hormone (ACTH) (18-39), human TFA is a corticotropinlike intermediate lobe peptide, which is is produced in the melanotrophs of the intermediate lobe of the pituitary .
|
- HY-P1840
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
|
Galanin Receptor Ligand M35 is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
- HY-P1840A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
Endocrinology
|
|
Galanin Receptor Ligand M35 TFA is a high-affinity ligand and antagonist of galanin receptor (Kd=0.1 nM). Galanin Receptor Ligand M35 TFA exerts a Ki values of 0.11 and 2.0 nM for human galanin receptor type 1 and 2, respectively .
|
- HY-P2247
-
|
|
JNK
|
Cancer
|
|
JTP10-△-R9 TFA is a selective JNK2 peptide inhibitor, with an IC50 of 89 nM, exhibiting 10-fold selectivity for JNK2 over JNK1 and JNK3 .
|
- HY-P2183A
-
|
proSAAS(221-242) TFA
|
Peptides
|
Neurological Disease
|
|
PEN(mouse) TFA (proSAAS(221-242) TFA) is the precursor of a number of peptides that function as neuropeptides .
|
- HY-P1562A
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 TFA is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM .
|
- HY-P2277
-
- HY-P1562
-
|
|
Bcl-2 Family
|
Cancer
|
|
PUMA BH3 is a p53 upregulated modulator of apoptosis (PUMA) BH3 domain peptide, acts as a direct activator of Bak, with a Kd of 26 nM.
|
- HY-P3143
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50?of 7.68?nM. BMSpep-57 binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST?and SPR assays, respectively.?BMSpep-57?facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P3143A
-
|
|
PD-1/PD-L1
|
Cancer
|
|
BMSpep-57 hydrochloride is a potent and competitive macrocyclic peptide inhibitor of PD-1/PD-L1 interaction with an IC50 of 7.68?nM. BMSpep-57 hydrochloride binds to PD-L1 with Kds of 19 nM and 19.88 nM in MST and SPR assays, respectively. BMSpep-57 hydrochloride facilitates T cell function by in creasing IL-2 production in PBMCs .
|
- HY-P3557
-
- HY-P3719
-
|
|
Peptides
|
Inflammation/Immunology
|
|
MOG peptide (35-55) is a fragment 35-55 of myelin oligodendrocyte glycoprotein (MOG) immunogenic peptide. MOG peptide (35-55) is specific to expanded CD4 + T cells, and induces experimental autoimmune encephalomyelitis (EAE) in animal model .
|
- HY-P4148
-
- HY-P4793
-
|
|
Peptides
|
Metabolic Disease
|
|
Acetyl-Heme-Binding Protein 1 (1-21) (human) is a short peptide. It consists of the first 21 amino acids of the hemopexin Acetyl-Heme-Binding Protein 1. Acetyl-Heme-Binding Protein 1 can bind to heme and play a role in heme metabolism and hemoglobin release .
|
- HY-P5282
-
|
|
Acyltransferase
|
Others
|
|
ApoA-I mimetic peptide (PVLDLFRELLNELLEALKQKLK) has good lecithin:cholesterol acyl transferase (LCAT) activation potency. ApoA-I mimetic peptide can be used for synthesis of peptide/lipid complex .
|
- HY-P2277A
-
- HY-P5325F
-
|
|
Bcl-2 Family
|
Others
|
|
Bid BH3 (80-99), FAM labeled is a biological active peptide. (This is a 5-FAM-labeled Bid BH3 HY-P5325 peptide.)
|
- HY-106323
-
|
KW-5139
|
Motilin Receptor
|
Metabolic Disease
|
|
[Leu13]-Motilin (KW-5139) is a motilin analogue. [Leu13]-Motilin stimulates gastrointestinal motility in the rabbit. [Leu13]-Motilin causes concentration-dependent contractions of the gastric antrum, duodenum, jejunum, ileum and the descending colon in vitro .
|
- HY-P1162
-
- HY-P2064
-
|
|
Bacterial
|
Infection
|
|
Lariatins is a novel anti-mycobacterial peptides with a lasso structure produced by Rhodococcus jostii K01-B0171 .
|
- HY-P5655
-
|
|
Bacterial
|
Infection
|
|
Maximin H4 is an antimicrobial peptide derived from the skin secretions of Chinese red belly toad Bombina maxima. Maximin H4 has activity against Escherichia coli ATCC25922, Staphylococcus aureus ATCC2592, Bacillus pyocyaneus CMCCB1010 and Candida albicans ATCC2002, the MIC values are 12, 6, 12, 6 μg/ml, respectively .
|
- HY-P3557A
-
- HY-P3176
-
|
|
Motilin Receptor
|
Others
|
|
Motilin, human, porcine is a gastrointestinal hormone, which is released during fasting and after eating, or by drinking water. Motilin, human, porcine promotes enteric cholinergic activity in human stomach with an EC50 of 33 nM, and thus modulates gastrointestinal motility function .
|
- HY-P10316
-
|
Calmodulin-Dependent Protein Kinase I (299-320) Binding Domain
|
CaMK
|
Others
|
|
CaMKI (299-320) refers to a peptide consisting of residues 299-320 of Calcium/calmodulin-dependent protein kinase I (CaMKI). CaMKI (299-320), as a protein kinase, has a high affinity interaction with Ca 2+-CAM (Kd≤1 nM≤1 nM), which can phosphorylate specific substrate proteins, thereby regulating their activity. CaMKI (299-320) contains the CAM-binding domain and the self-inhibition domain, and CaMKI (299-320) can be used to study cell physiological processes, including cell proliferation, differentiation, and apoptosis .
|
- HY-17584A
-
|
|
Guanylate Cyclase
|
Cancer
|
|
Linaclotide acetate is a potent and selective guanylate cyclase C agonist; developed for the treatment of constipation-predominant irritable bowel syndrome (IBS-C) and chronic constipation.
|
- HY-P10492
-
|
|
Peptides
|
Others
Metabolic Disease
|
|
Tregitope 289 is a peptide derived from the Fc region of immunoglobulin G (IgG) and is a highly conserved T cell epitope that stimulates the expansion of natural regulatory T cells. Co-delivery of Tregitope 289 with type 1 diabetes (T1D) antigens delays the development of hyperglycemia and reduces the incidence of diabetes in the NOD mouse model. Tregitope 289 can be used to study T1D and other autoimmune diseases .
|
- HY-P10514
-
|
|
Peptides
|
Others
|
|
Transportan 10 is a derivative of Transportan (HY-P1732) and is an amphiphilic cell penetrating peptide (CPP). Transportan 10 helps molecules penetrate cell membrane barriers by directly interacting with the lipid bilayer. Transportan 10 can be used in gene therapy or siRNA delivery vector research .
|
- HY-P10499
-
|
|
CaMK
|
Others
|
|
[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) is a modified fragment of calcium/calmodulin-dependent protein kinase II that contains the active domain of CaMKII and has an alanine substitution at position 286. [Ala286]-Calmodulin-Dependent Protein Kinase II (281-302) can be used to develop more potent CaMKII inhibitors .
|
- HY-P10779
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
flg22Pst is a peptide that can be derived Pseudomonas syringae pv. tabaci and serves as an effective elicitor for the plant immune system. flg22Pst can induce callose deposition in plants, trigger plant immune responses, and thereby assist plants in defending against pathogen invasion .
|
- HY-P10796
-
|
|
MAPKAPK2 (MK2)
|
Inflammation/Immunology
|
|
YARA peptide, a cell-penetrating peptide, is a MK2 inhibitor. YARA-loaded nanoparticles decreases the levels of inflammatory cytokines (IL-1β, IL-6, and TNF-α) in an ex vivo skin culture model. YARA peptide is promising for research of atopic dermatitis (AD) .
|
- HY-P0270
-
|
Magainin II
|
Bacterial
Antibiotic
Fungal
|
Infection
|
|
Magainin 2 (Magainin II) is an?antimicrobial?peptide (AMP) isolated from the skin of the African clawed frog Xenopus laevis. Magainin 2 displays antibiotic activity against numerous gram-negative and gram-positive bacteria. Magainin 2 also is active against protozoa . Magainin 2 exerts its cytotoxicity effects by preferential interactions with anionic phospholipids abundant in bacterial membranes .
|
- HY-P2633
-
|
AC-100
|
Peptides
|
Metabolic Disease
|
|
Dentonin (AC-100) is a synthetic fragment derived from MEPE. Dentonin enhances osteogenesis by promoting osteoprogenitor adhesion and facilitates immature adherent cells survival. Dentonin has no significant effect to mature osteoblasts. Dentonin can be used for the research of phosphate homeostasis and bone metabolism .
|
- HY-P3965A
-
- HY-P5435
-
|
|
Peptides
|
Others
|
|
LKBtide is a biological active peptide. (This is a peptide substrate that is phosphorylated by Serine/Threonine kinase 11 (STK11), also known as LKB1. LKBtide is derived from sucrose non-fermenting 1 (SNF1) protein kinase, which is normally activated by the LKB1/AMP-activated protein kinase (AMPK) signaling pathway.)
|
- HY-P4895
-
|
|
Oxytocin Receptor
|
Neurological Disease
|
|
(d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin (OVT) is an oxytocin receptor antagonist. (d(CH2)51,Tyr(Me)2,Orn8)-Oxytocin can be used for the research of neurological disease .
|
- HY-P5827
-
- HY-P0041
-
- HY-P0041A
-
- HY-P10048
-
- HY-P10104
-
|
|
Caspase
|
Cancer
|
|
Smac-N7, Penetratin conjugated is a caspase activator derived from the second mitochondria-derived activator of caspases (SMAC) .
|
- HY-P10305
-
|
|
Peptides
|
Metabolic Disease
|
|
PB-119 is a PEGylated Exenatide. PB-119 decreases glycemic levels by improving beta-cell function and insulin resistance. PB-119 can be used for research of type 2 diabetes .
|
- HY-P10400
-
|
|
Peptides
|
Inflammation/Immunology
|
|
AtPep1 is a plant elicitor peptide. AtPep1 activates transcription of the defensive gene defensin (PDF1.2) and activates the synthesis of H2O2, which are components of the innate immune response against pathogens. AtPep1 can be isolated from extracts of Arabidopsis leaves .
|
- HY-159191S
-
- HY-P2595
-
|
|
Peptides
|
Cardiovascular Disease
|
|
SKF 103784 is an vasopressin antagonist with activity against vasopressin. SKF 103784 inhibits the physiological response caused by antidiuretic and is therefore used to study biological processes related to water and salt balance. SKF 103784 can also be used to explore pathological mechanisms related to cardiovascular diseases and endocrine dysfunction .
|
- HY-P0256
-
Apamin
4 Publications Verification
Apamine
|
Potassium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
Apamin (Apamine) is an 18 amino acid peptide neurotoxin found in apitoxin (bee venom), is known as a specifically selective blocker of Ca 2+-activated K + (SK) channels and exhibits anti-inflammatory and anti-fibrotic activity .
|
- HY-P1753
-
|
|
HIV
|
Infection
|
|
VIR-165 is a modified form of virus inhibitory peptide (VIRIP) that binds the fusion peptide of the gp41 subunit and prevents its insertion into the target membrane. VIRIP inhibits a wide variety of human immunodeficiency virus type 1 (HIV-1) strains .
|
- HY-P1817
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP-38 (16-38), human, mouse, rat demonstrates potent, efficacious, and sustained stimulatory effects on sympathetic neuronal NPY and catecholamine production . PACAP is a potent activator of cAMP formation .
|
- HY-P1306
-
|
|
GHSR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Obestatin(rat), encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) has anti-inflammatory, anti-myocardial infarction and antioxidant activities .
|
- HY-P1306A
-
|
|
GHSR
|
Cardiovascular Disease
Inflammation/Immunology
|
|
Obestatin(rat) TFA, encoded by the Ghrelin gene, is a cpeptide, comprised of 23 amino acids. Obestatin(rat) TFA suppresses food intake, inhibits jejunal contraction, and decreases body-weight gain. Obestatin is an endogenous ligand of G-protein coupled receptor 39 (GPR39). Obestatin(rat) TFA has anti-inflammatory, anti-myocardial infarction and antioxidant activities .
|
- HY-P3499
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
|
|
Dolcanatide is an orally active GC-C (guanylate cyclase-C) agonist. Dolcanatide shows laxative, anti-nociceptive and anti-inflammatory activity. Dolcanatide can be used in inflammatory bowel disease research .
|
- HY-P3569
-
|
|
Peptides
|
Others
|
|
[D-Val22, Phe33] Big Endothelin-1 (16-38), human is a polypeptide.
|
- HY-P4118
-
|
Penetrating analog
|
Peptides
|
Others
|
|
EB1 peptide (Penetrating analog), a Penetratin peptide derivative, is an amphipathic cell-penetrating peptide (CPP). EB1 peptide has the potential for intracellular drug delivery research .
|
- HY-P1130
-
|
Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
M871 (Galanin-(2-13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide) is a selective galanin receptor type 2 (GalR2) antagonist. M871 exhibits Ki values of 13.1 nM and 420 nM for GalR2 and GalR1, respectively. M871 can be used for research on GalR2-related diseases (such as epilepsy, pain) .
|
- HY-P5601
-
|
|
Bacterial
Fungal
|
Infection
|
|
Thanatin is an inducible cationic antimicrobial peptide. Thanatin is a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
- HY-P0142
-
|
|
Guanylate Cyclase
|
Inflammation/Immunology
|
|
DT-3 is a membrane-permeable protein kinase G Iα inhibitory peptide. DT-3 is a guanylyl cyclase? inhibitor and shows pharmacological blockade of the cGMP–PKG signalling .
|
- HY-P3275
-
|
Aβ(17-40)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (17-40) (Aβ(17-40)) is a fragment of Amyloid-β peptide that has shown neurotoxic activities in SH-SY5Y and IMR-32 cells. β-Amyloid (17-40) can be used for the research of neurological disease .
|
- HY-P10152
-
|
|
Biochemical Assay Reagents
|
Infection
|
|
INF7 is a derivative of the N-terminal domain of the HA2 protein that can be used to enhance the endosomal escape of polyplexes or liposome-encapsulated proteins .
|
- HY-P5601A
-
|
|
Bacterial
Fungal
|
Infection
|
|
Thanatin TFA is an inducible cationic antimicrobial peptide. Thanatin TFA s a pathogen-inducible single-disulfide-bond-containing β-hairpin AMP. Thanatin TFA displays broad-spectrum activity against both Gram-negative and Gram-positive bacteria as well as against various species of fungi with MICs of 0.3-40 µM, 0.6-40 µM and 0.6-20 µM, respectively. Thanatin TFA has the property of competitive replacement of divalent cations from bacterial outer membrane (OM), leading to OM disruption .
|
- HY-P10242
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 can be used for researches of muscle atrophic disorders .
|
- HY-P10372
-
|
|
Src
|
Cancer
|
|
pFYN peptide is a biotin-labled phosphorylated peptide substrate derived from FYN (a Src family kinase) .
|
- HY-P10621
-
- HY-P10624
-
- HY-P10718
-
|
|
Toll-like Receptor (TLR)
|
Inflammation/Immunology
|
|
IMG-2005 is a TLR signaling pathway inhibitor. IMG-2005 mimics the Toll/interleukin-1 receptor (TIR) domain of MyD88, thereby preventing its homodimerization, which causes damage to tracheal epithelial cells and triggers pulmonary immune diseases .
|
- HY-P10242A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 7 TFA is a 23 amino acids peptide, which is derived from amino acids 21 to 43 of the mouse myostatin prodomain. Myostatin inhibitory peptide 7 TFA inhibits myostatin with Kd of 29.7 nM. Myostatin inhibitory peptide 7 TFA can be used for researches of muscle atrophic disorders .
|
- HY-P1480
-
- HY-P1834
-
|
|
Peptides
|
Inflammation/Immunology
|
|
MARCKS Peptide(151-175), Phosphorylated is a phosphorylated peptide corresponding to the basic effector domain of myristoylated alanine-rich protein kinase C substrate protein (MARCKS). Phosphorylation of MARCKS Peptide (151-175) reverses its inhibition of phospholipase C (PLC)-catalyzed hydrolysis of phosphatidylinositol 4,5-bisphosphate (PIP2) .
|
- HY-P1949A
-
|
|
CXCR
|
Cardiovascular Disease
Cancer
|
|
Cyclic MKEY TFA is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY TFA also protects against stroke-induced brain injury in mice .
|
- HY-P2249
-
|
|
Arrestin
Apelin Receptor (APJ)
|
Cardiovascular Disease
|
|
ELA-21 (human) is an apelin receptor agonist with a pKi of 8.52. ELA-21 (human) completely inhibits Forskolin-induced cAMP production and stimulates β-arrestin recruitment with subnanomolar potencies. ELA-21 (human) is an agonist in G-protein-dependent and -independent pathways .
|
- HY-P1112
-
- HY-P1112A
-
|
|
Endothelin Receptor
|
Cardiovascular Disease
Neurological Disease
|
|
Sarafotoxin S6a TFA , a sarafotoxin analogue, is a endothelin receptor agonist and has an ETA/ETB selectivity profile similar to that of Endothelin-3 (HY-P0204). Sarafotoxin S6a TFA elicits the pig coronary artery with an EC50 value of 7.5 nM .
|
- HY-P2468
-
|
BADBH3 103-127 (human); BADBH3 (human)
|
Bcl-2 Family
|
Cancer
|
|
BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL. BAD (103-127) (human) is reported to have almost 800-fold higher affinity for Bcl-XL than the 16-mer peptide .
|
- HY-P2551
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Biotin-β-Amyloid (17-40) is a N-terminal-labelled biotinylated amyloid-?-(1-40) peptide. β-Amyloid (17-40) is a 24-residue fragment of the Aβ protein via?post-translational processing of amyloid precursor protein (APP) .
|
- HY-P1949
-
|
|
CXCR
|
Cardiovascular Disease
Cancer
|
|
Cyclic MKEY is a synthetic cyclic peptide inhibitor of CXCL4-CCL5 heterodimer formation, which protects against atherosclerosis and aortic aneurysm formation by mediating inflammation. Cyclic MKEY also protects against stroke-induced brain injury in mice .
|
- HY-P4352
-
|
|
HIV
|
Others
|
|
HIV-2 Peptide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4805
-
- HY-P4697
-
- HY-P5607
-
|
|
Peptides
|
Infection
|
|
Bombinin is an antimicrobial peptide derived from frog Bombina variegata. Bombinin has a protective effect on aminopeptidase .
|
- HY-P5615
-
|
|
Bacterial
|
Infection
|
|
XT-2 peptide is an antimicrobial peptide derived from skin secretions of Xenopus tropicalis. XT-2 peptide has strong activity against E.coli, the vaule of MIC is 8 μM .
|
- HY-P2719
-
|
|
Peptides
|
Neurological Disease
|
|
Fibronectin Type III Connecting Segment Fragment 1-25 is a peptide that is responsible for melanoma cell adhesion, and plays an important role in development of the peripheral nervous system in chicken .
|
- HY-P1011
-
- HY-P10248
-
|
|
Peptides
|
Endocrinology
|
|
Atriopeptin I rat, mouse is an atrial natriuretic peptide, which stimulates the testosterone production with half-maximum stimulation of 38 nM .
|
- HY-P10446
-
|
|
Radionuclide-Drug Conjugates (RDCs)
Epigenetic Reader Domain
|
Cancer
|
|
TAT-PiET-PROTAC is a proteolysis-targeting chimera (PROTAC)-modified TAT-PiET (HY-P10445). TAT-PiET is a cell-penetrating peptide targeting the extra-terminal (ET) domain of BRD4. TAT-PiET-PROTAC can disrupt the interaction between the breast cancer oncogene BRD4/JMJD6 and inhibit the growth of breast cancer cells. TAT-PiET-PROTAC also resists the endocrine resistance of ERα-positive breast cancer cells and is a potential inhibitor of breast cancer .
|
- HY-P10471
-
|
MARCKS-ED
|
MARCKS
PKC
|
Others
|
|
MPSD (MARCKS-ED) is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD can sense membrane curvature and recognize phosphatidylserine. MPSD can be utilized as biological probe to study membrane shape and lipid composition .
|
- HY-P10471A
-
|
MARCKS-ED TFA
|
MARCKS
PKC
|
Others
|
|
MPSD TFA (MARCKS-ED TFA) is the TFA salt form of MPSD (HY-P10471). MPSD TFA is a 25-amino acid peptide based on the effector domain sequence of the intracellular membrane protein myristoylated alanine-rich C-kinase substrate (MARCKS). MPSD TFA can sense membrane curvature and recognize phosphatidylserine. MPSD TFA can be utilized as biological probe to study membrane shape and lipid composition .
|
- HY-P10471B
-
|
|
Peptides
|
Others
|
|
Ala-MPSD is a control peptide for MPSD (HY-P10471). In Ala-MPSD, the four serine residues of MPSD are substituted by alanines .
|
- HY-P10471C
-
|
|
Peptides
|
Others
|
|
Ala-MPSD TFA is a control peptide for MPSD (HY-P10471). In Ala-MPSD TFA, the four serine residues of MPSD are substituted by alanines .
|
- HY-P10476
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 can be used for researches of muscle atrophic disorders .
|
- HY-P5765
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin (1-13)-spantide I is a chimeric peptide composed of the N-terminal fragment of galanin (amino acids 1-13) and spantide, a known substance P receptor antagonist. Galanin (1-13)-spantide I has a high affinity for spinal galanin receptor (Kd=1.16 nM). Galanin (1-13)-spantide I can be used to study the effects of galanin on feeding behavior .
|
- HY-P4697A
-
|
|
Thyroid Hormone Receptor
|
Endocrinology
|
|
pTH (44-68) (human) TFA is a fragment of human parathyroid hormone (pTH) that lacks the adenylate cyclase-stimulating activity of intact pTH. pTH (44-68) (human) TFA can be used to study the mechanism of action of pTH .
|
- HY-P10476A
-
|
|
TGF-beta/Smad
|
Others
|
|
Myostatin inhibitory peptide 2 (compd 2) TFA is a myostatin inhibitor with a Kd of 35.9 nM. Myostatin inhibitory peptide 2 TFA can be used for researches of muscle atrophic disorders .
|
- HY-P1098
-
Ac2-26
4 Publications Verification
|
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
- HY-P1098A
-
|
|
NF-κB
|
Inflammation/Immunology
|
|
Ac2-26 TFA, an active N-terminal peptide of annexin A1 (AnxA1), attenuates ischemia-reperfusion-induced acute lung injury. Ac2-26 also decreases AnxA1 protein expression, inhibits the activation of NF-κB and MAPK pathways in the injured lung tissue .
|
- HY-P1782
-
- HY-P1889A
-
|
|
Bcl-2 Family
|
Inflammation/Immunology
|
|
Bim BH3, Peptide IV TFA is a 26-residue peptide from BH3-only protein Bim, which belongs to the pro-apoptotic group of the Bcl-2 family of proteins .
|
- HY-P2499
-
|
|
Bcl-2 Family
|
Cancer
|
|
BAD (103-127) (human), FAM-labeled is a FAM-labeled human BAD (103-127) (HY-P2468). BAD (103-127) (human), the 25-mer Bad peptide, is derived from the BH3 domain of BAD, can antagonize the function of Bcl-xL .
|
- HY-P4843
-
|
|
Peptides
|
Metabolic Disease
|
|
Gastric Inhibitory Polypeptide (6-30) amide (human) is an incretin hormone. Gastric Inhibitory Polypeptide (6-30) amide (human) can be used for the research of diabete .
|
- HY-P5003
-
|
|
MMP
|
Inflammation/Immunology
|
|
Collagen Type II Fragment is an anti-inflammatory peptide that potently inhibits collagen-induced arthritis (CIA) in mice. Collagen Type II Fragment can be used for research on inflammation and immunity .
|
- HY-P5635
-
|
BLP-4
|
Peptides
|
Infection
|
|
Bombinin-like peptide 4 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis .
|
- HY-P1098B
-
|
|
IKK
|
Inflammation/Immunology
|
|
Ac2-26 ammonium is the N-terminal peptide of annexin 1, and has anti-inflammatory activity. Ac2-26 ammonium induces a decrease in IKKβ protein in lysosomes by chaperone-mediated autophagy (CMA). Ac2-26 ammonium ameliorates lung ischemia-reperfusion injury. Ac2-26 ammonium also inhibits airway inflammation and hyperresponsiveness in an asthma rat model .
|
- HY-P5984
-
|
|
mTOR
|
Others
|
|
Thioether-cyclized helix B peptide, CHBP can improve metabolic stability and renoprotective effect through inducing autophagy via inhibition of mTORC1 and activation of mTORC2 .
|
- HY-P5984A
-
|
|
mTOR
|
Others
|
|
Thioether-cyclized helix B peptide, CHBP (TFA) is the TFA form of Thioether-cyclized helix B peptide, CHBP (HY-P5984). Thioether-cyclized helix B peptide, CHBP (TFA) can improve metabolic stability and renoprotective effect through inducing autophagy via inhibition of mTORC1 and activation of mTORC2 .
|
- HY-P10115
-
|
|
STAT
|
Cancer
|
|
APT STAT3 is a specific STAT3-binding peptide. APT STAT3 can bind STAT3 with high specificity and affinity (～231 nmol/L). APT STAT3 is a tractable agent for translation to target the broad array of cancers harboring constitutively activated STAT3 .
|
- HY-P2670
-
|
|
Peptides
|
Others
|
|
SN50M, a mutant peptide of SN50 (HY-P0151), is a cell membrane-permeable inactive control peptide .
|
- HY-P2378
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Neuromedin U-25 human is the active form of neuromedin U in human. Neuromedin U-25 human inhibits glucose-stimulated insulin secretion, which leads to early-onset obesity. Neuromedin U-25 serves as vasoconstrictor in human vascular beds .
|
- HY-P10409
-
|
Small humanin-like peptide 2
|
Apoptosis
|
Others
|
|
SHLP2 (Small humanin-like peptide 2) is a small molecule peptide encoded by mitochondrial DNA, belonging to mitochondria derived peptide. SHLP2 has the activity of regulating apoptosis and inhibits cell death. SHLP2 can be used in the study of diseases related to mitochondrial dysfunction and anti-aging diseases .
|
- HY-P0175
-
740 Y-P
Maximum Cited Publications
158 Publications Verification
740YPDGFR; PDGFR 740Y-P
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P (740YPDGFR; PDGFR 740Y-P) is a potent and cell-permeable PI3K activator. 740 Y-P readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone .
|
- HY-P1567
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (10-35), amide is composed of 26 aa (10-35 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease.
|
- HY-P1210
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
- HY-P1210A
-
|
|
Melanocortin Receptor
|
Endocrinology
|
|
Lys-γ3-MSH(human) TFA is a melanocortin peptide derived from the C-terminal of the fragment of pro-opiomelanocortin (POMC). Lys-γ3-MSH(human) TFA potentiates the steroidogenic response of the rat adrenal to adrenocorticotrophin (ACTH). Lys-γ3-MSH(human) TFA is a potent stimulator of lipolysis with an apparent EC50 of 3.56 nM. Lys-γ3-MSH(human) TFA can activate hormone sensitive lipase (HSL) and Perilipin A resulting in lipolysis .
|
- HY-P0175A
-
|
740YPDGFR TFA; PDGFR 740Y-P TFA
|
PI3K
Autophagy
|
Cancer
|
|
740 Y-P TFA is a potent and cell-permeable PI3K activator. 740 Y-P TFA readily binds GST fusion proteins containing both the N- and C- terminal SH2 domains of p85 but fails to bind GST alone .
|
- HY-P4906
-
|
|
Peptides
|
Others
|
|
Atrial Natriuretic Factor (5-27) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3509A
-
|
|
Peptides
|
Cancer
|
|
PNC-28 acetate is a peptide from the mdm-2-binding domain (residues 17–26) of the p53 protein which contains a membrane crossing-penetratin sequence. PNC-28 acetate can be used for pancreatic cancer research .
|
- HY-P5291
-
|
Caerulein precursor fragment
|
Peptides
|
Metabolic Disease
|
|
CPF-7 (Caerulein precursor fragment) is an insulin-releasing peptide that stimulates the release of insulin. CPF-7 can induce epithelial-mesenchymal transition by upregulating Snai1 expression in PANC-1 ductal cells. CPF-7 also induces exocrine plasticity by upregulating Ngn3 expression. CPF-7 can be used in the research of type 2 diabetes .
|
- HY-P5492
-
|
Delta-lysin
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin), a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin is a model in the study of peptides interacting with membranes. Delta-hemolysin is poorly active against bacteria .
|
- HY-P4985
-
|
|
Peptides
|
Neurological Disease
|
|
γ3-MSH is derived from the N-terminal segment of pro-opiomelanocortin (POMC). γ3-MSH stimulates aldosterone secretion by human adrenal tumor cells in culture .
|
- HY-P5658
-
|
|
Bacterial
|
Infection
|
|
Brevinin-1E is an antimicrobial peptide derived from the skin secretions of Rana esculenta .
|
- HY-P5978
-
|
ANP 127-150 (rat)
|
Peptides
|
Cardiovascular Disease
|
|
Atriopeptin III (ANP 127-150) (rat), a 24-amino acid atrial peptide, is a potent vasodilator and natriuretic/diuretic agent. Atriopeptin III (rat) improves renal functions and decreases blood pressure in a ureter-obstructed rat kidney model. Atriopeptin III (rat) can be used for research of chronic renal failure .
|
- HY-P10074
-
|
|
ERK
|
Inflammation/Immunology
|
|
TAT-MEK1 is an inhibitor ofERK2, consisting of TAT and MEK1 (N-terminal), TAT (YGRKKRRQRRR) derived from human immunodeficiency (HIV-1) transcriptional trans activator (TAT), is a cell-penetrating peptide. TAT-MEK1 IC50 in vitro for ERK2 is 29 μM .
|
- HY-P5492A
-
|
Delta-lysin TFA
|
Bacterial
|
Others
|
|
Delta-hemolysin (Delta-lysin) TFA, a 26 amino acid peptide, is a hemolytic peptide produced by Staphylococcus. Delta-hemolysin TFA may slightly perturb a membrane or lead to cell lysis. Delta-hemolysin TFA is a model in the study of peptides interacting with membranes. Delta-hemolysin TFA is poorly active against bacteria .
|
- HY-P3060
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Atriopeptin II rat, mouse is an atrial natriuretic peptide, which acts as diuretic and natriuretic agent, and a potent relaxant of vascular smooth muscle .
|
- HY-P10328
-
|
|
DNA/RNA Synthesis
|
Metabolic Disease
|
|
Vasoactive intestinal contractor is a novel member of the endothelin family. Vasoactive intestinal contractor stimulates a rapid increase in the intracellular Ca 2+ concentration in fura-2-overexpressed Swiss 3T3 cells [1.
|
- HY-P10279
-
|
Human atrial natriuretic factor (102–126)
|
Natriuretic Peptide Receptor (NPR)
|
Cardiovascular Disease
Others
|
|
Anaritide is a synthetic form of atrial natriuretic peptide (ANP) composed of 25 amino acids. Anaritide increases glomerular filtration rate by dilating into and contracting out the bulbar arterioles. Anaritide can be used to study the effects on patients with acute tubular necrosis, particularly in improving dialysis free survival .
|
- HY-P0238
-
|
|
Peptides
|
Cancer
|
|
Gastrin-Releasing Peptide, human (GRP) belongs to the bombesin-like peptide family, and is not a classical hypothalamic-hypophyseal regulatory hormone since it plays only a perfunctory role in the mediation of pituitary hormone release.
|
- HY-P1223
-
- HY-P1468
-
|
Amyloid β-Protein (1-28)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-28) is a β-Amyloid protein fragment involved in metal binding. Beta-amyloid is a peptide that forms amyloid plaques in the brains of Alzheimer's disease (AD) patients.
|
- HY-P1546
-
|
|
Bacterial
|
Infection
|
|
Bombinin-Like Peptide (BLP-1) is an antimicrobial peptide from Bombina species.
|
- HY-P4502
-
|
|
Peptides
|
Others
|
|
(Des-Thr5)-Glucagon is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4504
-
|
|
Peptides
|
Others
|
|
(Des-Thr7)-Glucagon is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4195
-
|
|
IPK Superfamily
|
Metabolic Disease
|
|
[K15,R16,L27]VIP(1-7)/GRF(8-27), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
- HY-P5465
-
|
|
Bacterial
|
Others
|
|
Lactoferricin H, Lactotransferrin (37-61), human is a biological active peptide. (This is an antimicrobial peptide derived from human lactotransferrin amino acid residues 37-61.)
|
- HY-103285
-
|
Porcine gastrin-releasing peptide 27
|
Peptides
|
Cancer
|
|
GRP (porcine) (Porcine gastrin-releasing peptide 27) is the putative mammalian analog of Bombesin (HY-P0195). GRP (porcine) activates the release of a number of gastroenteropancreatic (GEP) peptides into the peripheral circulation. GRP (porcine) stimulates gastrin release and exocrine pancreatic secretion. GRP (porcine) is a useful marker of neuroendocrine differentiation in many tumors .
|
- HY-P2281
-
- HY-P5604
-
|
|
Bacterial
|
Infection
|
|
Maximin 1 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 1 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5605
-
|
|
Bacterial
|
Infection
|
|
Maximin 2 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 2 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5608
-
|
|
Bacterial
|
Infection
|
|
Maximin 4 is an antimicrobial peptide derived from skin secretions of Bombina maxima. Maximin 4 has cytotoxicity on tumor cells and spermicidal effect .
|
- HY-P5611
-
|
|
Bacterial
|
Infection
|
|
Maximin 7 is an antimicrobial peptide derived from toad Bombina maxima .
|
- HY-P5580
-
|
|
Bacterial
|
Infection
Cancer
|
|
Dermaseptin-B3 inhibits the growth of Gram-positive and Gram-negative bacteria (MIC: 1.3, 2.3, 5.0, 2.6, 2.3 μM for S. aureus, P. aeruginosa, P. aeruginosa, E. (ATCC 25922), E. (54127) respectively). Dermaseptin-B3 also inhibits tumor cell proliferation .
|
- HY-P5621
-
|
|
Bacterial
|
Infection
|
|
Maximin 63 is an antimicrobial peptide derived from the brain of a toad. Maximin 63 has strong activity against S.aureus (MIC: 18.8 μg/mL) .
|
- HY-P5633
-
|
BLP-2
|
Peptides
|
Infection
|
|
Bombinin-like peptide 2 is an antimicrobial peptide derived from skin secretions of asian toad Bombina orientalis .
|
- HY-P5636
-
|
BLP-7; Maximin 6
|
Bacterial
|
Infection
|
|
Bombinin-like peptide 7 is an antimicrobial peptide derived from Bombina orientalis .
|
- HY-P5666
-
|
|
Bacterial
|
Infection
|
|
Maximin 15 is an antimicrobial peptide derived from the toad brain. Maximin 15 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 9.4, 18.8, 75 μg/mL, respectively .
|
- HY-P5668
-
|
|
Bacterial
|
Infection
|
|
Maximin 28 is an antimicrobial peptide derived from the toad brain. Maximin 28 is active against Staphylococcus aureus, Escherichia coli and Bacillus subtilis, with MIC values of 4.7, 9.4, 75 μg/mL, respectively .
|
- HY-P5672
-
|
|
Bacterial
|
Infection
|
|
Maximin 39 is an antimicrobial peptide derived from the toad brain. Maximin 39 is active against Staphylococcus aureus and Escherichia coli, with MIC values of 18.8, 37.5 μg/mL, respectively .
|
- HY-P5685
-
|
|
Bacterial
|
Infection
|
|
Maximin 49 is an antimicrobial peptide. Maximin 49 has antibacterial activity against S. aureus (MIC: 18.8 μg/mL). Maximin 49 has hemolytic activities against human and rabbit red cells .
|
- HY-P5612
-
- HY-P4195A
-
|
|
IPK Superfamily
|
Metabolic Disease
|
|
[K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate) is the acetate of [K15,R16,L27]VIP(1-7)/GRF(8-27) (HY-P4195). [K15,R16,L27]VIP(1-7)/GRF(8-27) (acetate), a VIP1 selective agonist, exhibits IC50 values of binding of 2 nM, 1 nM, 30,000 nM for the human VIP1, rat VIP1, rat VIP2 receptors, respectively . VIP: VASOACTIVE Intestinal Polypeptide
|
- HY-P10058
-
|
|
Biochemical Assay Reagents
|
Cancer
|
|
cpm-1285m is a cell-permeable mutated peptide analogue of cpm-1285 (Bcl-2 inhibitory peptide). cpm-1285m contains a single substitution of alanine for Leu-151, and exhibits a decrease in Bcl-2 binding affinity with a reduction in IC50 of ∼15-fold. cpm-1285m can be used as a control of cpm-1285 .
|
- HY-P10057
-
|
|
Apoptosis
|
Cancer
|
|
cpm-1285 induces apoptosis by functionally blocking intracellular Bcl-2 and related death antagonists. cpm-1285 shows strong binding potency to Bcl-2 with an IC50 value of 130 nM. cpm-1285 reduces tumor burden in mice .
|
- HY-P10387
-
|
|
METTL3
Apoptosis
|
Cancer
|
|
RSM3, a stapled peptide, is a METTL3-METTL14 inhibitor with an Kd of 3.10 μM. RSM3 inhibits tumor growth while induces cell apoptosis. RSM3 can be used for study of cancer .
|
- HY-P10387A
-
|
|
METTL3
Apoptosis
|
Cancer
|
|
RSM3 TFA, a stapled peptide, is a METTL3-METTL14 inhibitor with an Kd of 3.10 μM. RSM3 TFA inhibits tumor growth while induces cell apoptosis. RSM3 TFA can be used for study of cancer .
|
- HY-P10703
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p2 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10702) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p2 is promising for the development of nanomaterials in the biomedical field .
|
- HY-P10702
-
|
|
Biochemical Assay Reagents
|
Others
|
|
SAF-p1 is a self-assembling fiber peptide that can form sticky-ended heterodimers by assembling with SAF-p2 (HY-P10703) through complementary amino acid sequences. These heterodimers further self-assemble into long-chain fiber structures. SAF-p1 is promising for the development of nanomaterials in the biomedical field .
|
- HY-P0091
-
|
Thymosin α1
|
Influenza Virus
|
Cancer
|
|
Thymalfasin is an immunomodulating agent able to enhance the Thl immune response.
|
- HY-P0082
-
|
Glucagon
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine is a peptide hormone, produced by pancreatic α-cells. Glucagon stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine activates HNF4α and increases HNF4α phosphorylation .
|
- HY-P1339
-
- HY-P1511
-
- HY-P1339A
-
- HY-P1874
-
|
|
Calmodulin
|
Neurological Disease
|
|
Calmodulin-Dependent Protein Kinase II (281-309) is a peptide of calcium/calmodulin-dependent protein kinase II (CaM-kinase II) .
|
- HY-P0082A
-
|
Glucagon hydrochloride
|
GCGR
|
Metabolic Disease
Cancer
|
|
Glucagon (1-29), bovine, human, porcine hydrochloride is a peptide hormone, produced by pancreatic α-cells. Glucagon hydrochloride stimulates gluconeogenesis . Glucagon (1-29), bovine, human, porcine hydrochloride activates HNF4α and increases HNF4α phosphorylation .
|
- HY-P1340
-
|
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
[Ala11,D-Leu15]-Orexin B(human) is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
- HY-P1340A
-
|
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
[Ala11,D-Leu15]-Orexin B(human) TFA is a potent and selective orexin-2 receptor (OX2) agonist. [Ala11,D-Leu15]-Orexin B(human) TFA shows a 400-fold selectivity for the OX2 (EC50=0.13 nM) over OX1 (52 nM) .
|
- HY-P1143
-
|
|
GCGR
|
Metabolic Disease
|
|
[Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes .
|
- HY-P1143A
-
|
|
GCGR
|
Metabolic Disease
|
|
[Des-His1,Glu9]-Glucagon amide TFA is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide TFA is potentially useful in the study of the pathogenesis of diabetes .
|
- HY-P4590
-
- HY-P4592
-
- HY-P5894
-
|
Galanin-like peptide (3-32)
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
human GALP (3-32) (Galanin-like peptide (3-32)) is a potent galanin receptor agonist with high affinity for both GalR1 (IC50=33 nM) and GalR2 (IC50=15 nM) in a competitive binding study. human GALP (3-32) exhibits the high potency in altering the extracellular acidification rate of SH-SY5Y cells transfected with GalR2 (EC50=360 nM) .
|
- HY-P1468F
-
|
Biotin-amyloid β-protein (1-28)
|
Amyloid-β
|
Others
|
|
Biotin-β-amyloid (1-28) (Biotin-amyloid β-protein (1-28)) is abiotinylated β-Amyloid (1-28) (HY-P1468).
|
- HY-P5552
-
|
|
Bacterial
Parasite
Fungal
|
Infection
|
|
Melimine is a hybrid antimicrobial peptide of Melittin (HY-P0233) and Protamine. Melimine is active against P. aeruginosa and S. aureus. Melimine has broad spectrum activity against bacteria, fungi and protozoa .
|
- HY-P5587
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S5 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5405
-
|
Transducible TAT-HA fusogenic peptide
|
Peptides
|
Others
|
|
dTAT-HA2 enhances TAT-Cre escape from macropinosomes. dTAT-HA2 is a transfusible, pH-sensitive, fusogenic peptide .
|
- HY-P10006
-
|
|
Opioid Receptor
|
Neurological Disease
|
|
Leumorphin, human is a potent kappa opioid receptor (κ opioid receptor) agonist. Leumorphin, human inhibits the contraction of the myenteric plexus-longitudinal muscle preparation of the guinea pig ileum .
|
- HY-P10080
-
- HY-P10138
-
- HY-P10138A
-
- HY-P10375
-
- HY-P1155
-
|
rGHRH(1-29)NH2
|
GHSR
|
Cancer
|
|
GRF (1-29) amide (rat) is a synthetic peptide which can stimulate the growth hormone (GH) secretion.
|
- HY-P1225
-
- HY-P4108
-
|
|
Influenza Virus
|
Infection
|
|
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide is a transactivator of transcription and hemaglutanin for endosomal release. TAT-HA2 Fusion Peptide enhances cellular uptake of macromolecules .
|
- HY-P4776
-
|
|
Peptides
|
Metabolic Disease
|
|
Acetyl-(D-Phe2,Lys15,Arg16,Leu27)-VIP (1-7)-GRF (8-27), a vasoactive intestinal peptide (VIP), is a VIP1 antagonist .
|
- HY-P5424
-
|
|
Peptides
|
Others
|
|
RyR1(3614-3643) is a biological active peptide. (the absolutely conserved peptide corresponding to the CaM-binding domain of RyR1 in all vertebrates)
|
- HY-P1468F1
-
|
5-FAM-Amyloid β-protein (1-28)
|
Amyloid-β
|
Others
|
|
5-FAM-β-Amyloid (1-28) is afluorescently labeled β-Amyloid (1-28) (HY-P1468).
|
- HY-P4969
-
- HY-P4888
-
|
|
Peptides
|
Neurological Disease
|
|
(Pyr11)-Amyloid β-Protein (11-40) (A beta 11pE-40) is a peptide. (Pyr11)-Amyloid β-Protein (11-40) can be used for the research of Alzheimer's disease .
|
- HY-P5583
-
|
|
Peptides
|
Infection
|
|
Dermaseptin-B9 is an antimicrobial peptide isolated from frogs of the Phyllomedusinae subfamily .
|
- HY-P5590
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S3 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5792
-
|
ANP (3-28) (human)
|
Endothelin Receptor
|
Cardiovascular Disease
Metabolic Disease
|
|
Atrial natriuretic peptide (3-28) (human) (ANP (3-28) (human)) is a peptide hormone that is synthesized and secreted by the atrial myocardium. Atrial natriuretic peptide (3-28) (human) is involved in the regulation of blood pressure, fluid balance, and electrolyte homeostasis .
|
- HY-P5074
-
|
|
GCGR
|
Metabolic Disease
|
|
GRPP (human) is a 30 amino acid Gcg-derived peptide. GRPP (human) causes slight increases in plasma insulin and decreases in plasma glucagon. GRPP (human) does not affect insulin secretion in rat islets .
|
- HY-P10020
-
|
hTERT (660–689)
|
Peptides
|
Cancer
|
|
Alrefimotide is a hTERT-derived immunogenic peptide. Alrefimotide has a sequence of ALFSVLNYERARRPGLLGASVLGLDDIHRA. Alrefimotide can be used in cancer immunotherapy research .
|
- HY-P10260
-
- HY-P10301
-
|
|
CXCR
|
Cancer
|
|
CXCL9(74-103) is a derivative peptide of CXCL9 that has a high affinity for glycosaminoglycans (GAGs) and can bind to GAGs. CXCL9(74-103) possesses anti-angiogenic properties, capable of reducing EGF, VEGF165, and FGF-2-mediated angiogenesis processes in vitro, without exhibiting cytotoxicity .
|
- HY-P10553
-
|
|
Apoptosis
|
Cancer
|
|
ARF(26–44), cell-permeable is a cell-penetrating peptide derived from a specific amino acid sequence of the p14ARF tumor suppressor protein. As a functional inhibitor of FoxM1, ARF(26–44) cell-permeable shows significant anti-tumor activity in the treatment of mouse hepatocellular carcinoma (HCC), significantly increasing tumor cell apoptosis and reducing tumor cell proliferation and angiogenesis. ARF(26–44), cell-permeable can be used in research on tumor therapy .
|
- HY-P6441
-
|
|
β-catenin
Wnt
|
Inflammation/Immunology
|
|
KP-6, a polypeptide, is a Wnt/β-catenin signal inhibitor. KP-6 inhibits TGF-β and blocks rush fibrosis signal path crucial in vivo. KP-6 suppresses Renal tissues damage and renal fibrosis, and reverse the course of disease of chronic kidney disease (CKD) .
|
- HY-P1556
-
|
|
PKG
|
Cardiovascular Disease
|
|
Vasonatrin Peptide (VNP) is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-P2080
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide,human is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P2080B
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide,human acetate is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) amide,human acetate dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P2317
-
|
|
Bacterial
Endogenous Metabolite
|
Infection
|
|
Cecropin P1, porcine is an antibacterial peptide that can be isolated from the upper part of the small intestine of the pig. Cecropin P1, porcine shows antibacterial activity against Gram-negative bacteria. Cecropin P1, porcine shows antiviral activity and inhibits PRRSV infection .
|
- HY-P2541
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide, porcine is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
- HY-P2541A
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30) amide, porcine TFA is a full glucose-dependent insulinotropic polypeptide (GIP) receptor agonist with high affinity equal to native GIP(1-42) . GIP (1-30) amide, porcine is a weak inhibitor of gastric acid secretion and potent stimulator of insulin.
|
- HY-P1556A
-
|
|
PKG
|
Metabolic Disease
|
|
Vasonatrin Peptide (VNP) TFA is a chimera of atrial natriuretic peptide (ANP) and C-type natriuretic peptide (CNP). Vasonatrin peptide TFA possesses the venodilating actions of CNP, the natriuretic actions of ANP, and unique arterial vasodilating actions not associated with either ANP or CNP. Vasonatrin Peptide TFA protects the diabetic heart against ischemia-reperfusion injury by inhibiting ER stress via the cGMP-PKG signaling pathway .
|
- HY-P4672
-
|
|
GCGR
|
Metabolic Disease
|
|
(Met(O)27)-Glucagon (1-29) (human, rat, porcine) is a modified glucagon. (Met(O)27)-Glucagon (1-29) (human, rat, porcine) has the same maximum glucose-synthesizing activity in rat hepatocytes as native glucagon, but it is less potent, suggesting a crucial role of methionine in the binding of glucagon to its hepatic receptor .
|
- HY-P4405
-
|
|
GHSR
|
Endocrinology
|
|
(D-Ala2)-GRF (1-29) amide (human) is a superagonist of GRF, exhibiting extremely high GH-releasing activity about 50 times that of GRF (1-29) in both pigs and rats .
|
- HY-P4751
-
- HY-P5320
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 can be used for research of diseases caused by accelerated apoptosis .
|
- HY-P5320A
-
|
|
Apoptosis
|
Others
|
|
TAT-BH4 (Bcl-xL) TFA is localized mainly at the mitochondria, prevents apoptotic cell death. TAT-BH4 (Bcl-xL) is a fusion peptide that combines the N-terminal cysteine conjugated protein transduction domain of HIV TAT protein (amino acids 49 to 57) with the Bcl-xL BH4 peptide. TAT-BH4 TFA can be used for research of diseases caused by accelerated apoptosis .
|
- HY-P0082F
-
|
|
Peptides
|
Others
|
|
Glucagon (1-29), FAM-labeled is a biological active peptide. (FAM labeled HY-P0082)
|
- HY-P2080C
-
|
|
Insulin Receptor
|
Metabolic Disease
|
|
GIP (1-30)-Myr is the Myr-modified GIP (1-30), which is a glucose-dependent insulinotropic polypeptide (GIP) fragment. GIP is an incretin hormone that stimulates insulin secretion and reduces postprandial glycaemic excursions. GIP (1-30) dose-dependently promotes insulin secretion over the range 10 -9-10 -6 M .
|
- HY-P4966
-
- HY-P5585
-
|
|
Bacterial
|
Infection
|
|
Dermaseptin-B4 is an antimicrobial peptide derived from the skin secretions of the South American frog Phyllomedusa bicolor .
|
- HY-P10267
-
|
|
Bombesin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Neuromedin B-30 is the neuropeptide, which is orignally isolated from porcine brain and spinal cord. , and may exhibit activity in stimulating smooth-muscle. Neuromedin B causes local vasodilation, increases vascular permeability and local hyperalgesia, thereby participating in neurogenic inflammation. Neuromedin B regulates appetite, body temperature, and behavioral responses to stress. Neuromedin B is also involved in regulating smooth muscle contraction and secretory function in the gastrointestinal tract .
|
- HY-P0264
-
|
Avexitide
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin(9-39) amide (Avexitide) is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for binding to GLP-1 receptors, thereby antagonizing the effects of excess GLP-1 secretion. Exendin(9-39) amide can be used to study postoperative hypoglycemia (PBH) .
|
- HY-P1227
-
- HY-P1471
-
|
22-52-Adrenomedullin (human)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
- HY-P1235
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine) inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P1236
-
|
Atrial natriuretic factor (1-28) (rat, mouse)
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P1520
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
- HY-P1235A
-
|
Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Carperitide acetate (Atrial Natriuretic Peptide (ANP) (1-28), human, porcine acetate) is a 28-amino acid hormone, that is normally produced and secreted by the human heart in response to cardiac injury and mechanical stretch. Carperitide acetate inhibits endothelin-1 secretion in a dose-dependent way.
|
- HY-P0069A
-
- HY-P1236A
-
|
Atrial natriuretic factor (1-28) (rat, mouse) TFA
|
Endothelin Receptor
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (ANP) (1-28), rat, mouse (TFA) is a major circulating form of ANP in rats, potently inhibits Angiotensin II (Ang II)-stimulated endothelin-1 secretion in a concentration-dependent manner.
|
- HY-P1471A
-
|
22-52-Adrenomedullin (human) (TFA)
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (22-52), human (22-52-Adrenomedullin human) TFA, an NH2 terminal truncated adrenomedullin analogue, is an adrenomedullin receptor antagonist. Adrenomedullin (AM) (22-52), human also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat .
|
- HY-P1520A
-
|
|
GnRH Receptor
|
Neurological Disease
|
|
Prolactin Releasing Peptide (1-31), human (acetate) is a high affinity GPR10 ligand that causes the release of the prolactin. Prolactin Releasing Peptide (1-31) binds to GPR10 for human and rats with Ki values of 1.03 nM and 0.33 nM, respectively. Prolactin Releasing Peptide (1-31) can be used for the research of the hypothalamo-pituitary axis .
|
- HY-P0211
-
|
|
GCGR
|
Cardiovascular Disease
|
|
[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human), a growth hormone releasing factor (GRF) analogue, is a vasoactive intestinal peptide (VIP) antagonist .
|
- HY-P4750
-
|
|
GHSR
|
Endocrinology
|
|
Acetyl-(D-Arg2)-GRF (1-29) amide (human) is an antagonist of growth hormone releasing factor (GRF). Acetyl-(D-Arg2)-GRF (1-29) amide (human) inhibits the release of growth hormone (GH) and can be used for endocrine research .
|
- HY-P4691
-
|
|
Peptides
|
Others
|
|
(Ser(PO3H2)396,404)-Tau Peptide (379-408) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4874
-
|
|
Melanocortin Receptor
|
Metabolic Disease
|
|
ACTH (7-38) (human) is the 7-38 fragment of human ACTH (1-39). human ACTH (1-39), known as a corticotropin inhibitory peptide (CIP), is an antagonist of the ACTH receptor and has no any corticosteroid activity .
|
- HY-P3709A
-
|
|
p62
E1/E2/E3 Enzyme
|
Neurological Disease
|
|
TRAF6 peptide TFA is a specific TRAF6-p62 inhibitor. TRAF6 peptide TFA potently abrogates NGF-dependent TrkA ubiquitination. TRAF6 peptide TFA has good research potential in neurological diseases such as alzheimer's disease (AD), parkinson's, ALS, head trauma, epilepsy and stroke .
|
- HY-P4870
-
- HY-120521
-
- HY-P4689
-
|
|
Peptides
|
Metabolic Disease
|
|
Prolactin-Releasing Peptide (1-31) (rat) is a UHR-1/GRP10 receptor ligand. Prolactin-Releasing Peptide (1-31) (rat) reduces fasting-induced food intake, increases plasma levels of LH, FSH, and testosterone in rats .
|
- HY-P5568
-
|
|
HIV
|
Infection
|
|
RP 71955 is an antimicrobial peptide against HIV-1 .
|
- HY-P3508A
-
|
|
MDM-2/p53
|
Cancer
|
|
PNC-27 acetate, a chimeric p53-penetratin peptide binds to HDM-2 in a p53 peptide-like structure, induces selective membrane-pore formation and leads to cancer cell lysis. PNC-27 acetate is an anticancer peptide. PNC-27 acetate can be used in acute myeloid leukemia research .
|
- HY-P0264A
-
|
Avexitide acetate
|
GLP Receptor
|
Metabolic Disease
|
|
Exendin(9-39) amide (Avexitide) acetate is a glucagon-like peptide-1 (GLP-1) antagonist that competes with endogenous GLP-1 for the GLP-1R, counteracting the effects of excessive GLP-1 secretion. Exendin(9-39) amide acetate can be utilized in Postbariatric hypoglycemia (PBH) research .
|
- HY-P2491
-
|
|
Fluorescent Dye
|
Cardiovascular Disease
Endocrinology
|
|
Atrial Natriuretic Peptide (1-28), human, porcine, Biotin-labeled, one of three mammalian natriuretic peptides (NPs), has endocrine effects on fluid homeostasis and blood pressure. Atrial Natriuretic Peptide has the potential for cardiovascular diseases research .
|
- HY-P3304
-
|
|
GHSR
|
Neurological Disease
Cancer
|
|
MR 409 is a selected growth hormone-releasing hormone (GHRH) agonist. MR 409 has remarkable neuroprotective effects through enhancing endogenous neurogenesis in cerebral ischemic mice. MR 409 also inhibits the in vivo growth of lung cancer .
|
- HY-P5307
-
|
INF7-A5K-TAT
|
Biochemical Assay Reagents
|
Others
|
|
Peptide A5K (INF7-A5K-TAT) is an RNP delivery peptide that delivers CRISPR RNPs to T cells. Peptide A5K effectively edits T cells without substantial impact on T cell viability .
|
- HY-P5307A
-
|
INF7-A5K-TAT acetate
|
Peptides
|
Cancer
|
|
Peptide A5K (INF7-A5K-TAT acetate) acetate is a INF7-TAT derivative and is used for CRISPR RNP delivery into T cells. Peptide A5K acetate effectively promotes the delivery of Cas9 RNP to natural killer (NK) cells .
|
- HY-P5014
-
- HY-P10076
-
|
L-HIV-TAT(48–57)-PP-JBD20
|
JNK
|
Metabolic Disease
|
|
TAT-JBD20 (L-HIV-TAT(48–57)-PP-JBD20) is a JNK peptide inhibitor. TAT-JBD20 can be used for research of diabetes .
|
- HY-P10325
-
- HY-P10438
-
|
|
Raf
|
Cancer
|
|
Tat-braftide is a peptide inhibitor designed to block the dimerization of BRAF, thereby inhibiting its kinase activity. The destruction of BRAF dimer by Tat-braftide makes BRAF protein more susceptible to proteasome degradation, directly inhibits the activity of BRAF kinase, and reduces the activation of MAPK signaling pathway. Tat-braftide can be used for the role of RAF kinase in MAPK signaling pathway and for the study of BRAF mutant cancers .
|
- HY-P2150
-
|
|
Somatostatin Receptor
|
Neurological Disease
Inflammation/Immunology
|
|
Cortistatin-29 is a neuropeptide. Cortistatin-29 alleviates neuropathic pain. Cortistatin-29 binds all somatostatin (SS) receptor subtypes with high affinity and shows IC50 values of 2.8 nM, 7.1 nM, 0.2 nM, 3.0 nM, 13.7 nM for SSTR1, SSTR2, SSTR3, SSTR4, SSTR5, respectively. Cortistatin-29 shows anti-fibrotic effects .
|
- HY-P0069
-
|
AM-111; XG-102
|
JNK
|
Others
|
|
D-JNKI-1 (AM-111) is a highly potent and cell-permeable peptide inhibitor of JNK.
|
- HY-P0220
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (6-38), human, ovine, rat is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
- HY-P0220A
-
|
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (6-38), human, ovine, rat TFA is a potent PACAP receptor antagonist with IC50s of 30, 600, and 40 nM for PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2, respectively.
|
- HY-P1867
-
- HY-P1021A
-
- HY-P1294A
-
|
|
CRFR
|
Neurological Disease
|
|
α-Helical CRF(9-41) TFA is a competitive CRF2 receptor antagonist with KB of ~100 nM. α-Helical CRF(9-41) TFA is also a partial agonist of CRF1 receptor with an EC50 of 140 nM .
|
- HY-P4071
-
|
Cathelicidin-OH antimicrobial peptide
|
Bacterial
|
Infection
|
|
OH-CATH is a natural antimicrobial peptide that can be isolated from the venom and tissue of Ophiophagus hannah (King Cobra) .
|
- HY-P4720
-
|
|
Interleukin Related
|
Inflammation/Immunology
Cancer
|
|
Interleukin-6 fragment (human) is a pleiotropic cytokine produced by lymphocytes and non-lymphocytes. The Interleukin-6 fragment (human) coding gene is located on human chromosome 7, with a length of approximately 5 kilobases. Interleukin-6 fragment (human) has potential applications in immune response, acute response, inflammation, tumors, and hematopoiesis .
|
- HY-P5205
-
|
|
Bacterial
|
Infection
|
|
Garvicin KS, GakA is a peptide at sizes of 34 amino acids to form bacteriocin garvicin KS (GarKS), with other 2 peptides, GakB, and GakC. Garvicin KS, GakA inhibits fibroblast viability and proliferation. Garvicin KS, GakA with GakB, is a potent combination with good peptide stability, antimicrobial efficacy, and fibroblast viability/proliferation effects. Garvicin KS peptides inhibit MSSA with MIC values in the order GakB >GakC >GakA .
|
- HY-P4855
-
|
|
Fungal
Bacterial
|
Infection
|
|
CRAMP (mouse) is an antimicrobial peptide. CRAMP (mouse) can be used for the research of biofilm-associated infections .
|
- HY-P5593
-
|
|
Fungal
|
Infection
|
|
Dermaseptin-S2 is an antimicrobial peptide derived from frog skin against filamentous fungi .
|
- HY-P5084
-
- HY-P10238
-
|
|
Apoptosis
|
Cancer
|
|
MYBMIM is an inhibitor for assembly of the molecular MYB:CBP/P300 complex. MYBMIM inhibits growth of leukemia cells .
|
- HY-P5829A
-
|
|
Bacterial
|
Infection
|
|
CRAMP (140-173) (mouse) TFA is a ortholog of human LL-37 antimicrobial peptide. CRAMP (140-173) (mouse) TFA inhibits LPS (HY-D1056)-induced responses, and can not colocalized with TLR3 in BEAS-2B cells .
|
- HY-169235
-
- HY-P1021
-
- HY-P1714A
-
|
FE 203799 TFA
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide TFA (FE 203799 TFA), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
- HY-P1714
-
|
FE 203799
|
GLP Receptor
|
Metabolic Disease
|
|
Apraglutide (FE 203799), a synthetic 33-amino-acid peptide and a long-acting GLP-2 analogue, enhances adaptation and linear intestinal growth in a neonatal piglet model of short bowel syndrome with total resection of the ileum .
|
- HY-P1239A
-
|
|
Peptides
|
Neurological Disease
|
|
Neuromedin S(rat) TFA is a 34-amino acids peptide from rat Neuromedin S. Neuromedin S is a neuropeptide isolated from rat brain. Neuromedin S acts as a ligand for the G protein-coupled receptor FM4/TGR-1
|
- HY-P2687
-
|
Urodilatin (human)
|
Peptides
|
Cardiovascular Disease
|
|
Ularitide (Urodilatin), natriuretic peptide, is a vasodilator. Ularitide binds to and activates renal receptors. Ularitide also regulates renal dopamine metabolism Ularitide can be used in the research of heart failure .
|
- HY-P3652
-
- HY-P4110
-
|
|
iGluR
|
Metabolic Disease
Inflammation/Immunology
|
|
TAT-NSF222 Fusion Peptide is a fusion polypeptide with two domains, a TAT domain, which enters cells through macropinocytosis, and an NSF domain that inhibits N-ethylmaleimide-sensitive factor (NSF). TAT-NSF222 Fusion Peptide is an exocytosis inhibitor .
|
- HY-P4112
-
|
|
Peptides
|
Others
|
|
TAT-NSF222scr Fusion Polypeptide, scrambled is a control peptide of TAT-NSF700 Fusion Peptide (HY-P4113). TAT-NSF222scr Fusion Polypeptide, scrambled is consisted of the intact TAT domain followed by the amino acid residues of NSF 222-243 in a scrambled order .
|
- HY-P4114
-
|
|
HIV
|
Others
|
|
TAT-NSF700scr consists the intact TAT domain and glycine linker, followed by the NSF amino acids in a random order. TAT-NSF700scr is used as a control peptide that does not inhibit SNAREmediated exocytosis .
|
- HY-P4116
-
|
pHLIP
|
Peptides
|
Metabolic Disease
Cancer
|
|
pH-Low Insertion Peptide (pHLIP) is a short, pH-responsive peptide capable of inserting across a cell membrane to form a transmembrane helix at acidic pH. pH-Low Insertion Peptide targets the acidic tumor microenvironment for tumors at early and metastatic stages with high specificity, used as a specific ligand. pH-Low Insertion Peptide successfully modify polylysine polymers to have the pH-responsive capability. pH-Low Insertion Peptide-based targeting of cancer presents an opportunity to monitor metabolic changes, and to selectively deliver imaging and therapeutic agents to tumors .
|
- HY-P4159B
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) acetate is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) acetate is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159A
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) TFA is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) TFA is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4159
-
|
|
ERK
|
Cardiovascular Disease
|
|
Endothelin-1 (1-31) (Human) is a potent vasoconstrictor and hypertensive agent. Endothelin-1 (1-31) (Human) is derived from the selective hydrolysis of big ET-1 by chymase .
|
- HY-P4542
-
|
|
CRFR
|
Endocrinology
|
|
(D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) is a CRF antagonist. (D-Phe12,Nle21,38,α-Me-Leu37)-CRF (12-41) (human, rat) prevents the IL-1a induced Luteinizing hormone (LH) inhibition .
|
- HY-P5878
-
|
|
Biochemical Assay Reagents
|
Metabolic Disease
|
|
RG33 Peptide is a diabetes inhibitor that significantly improves glucose clearance in insulin-resistant mice. RG33 Peptide effectively solubilizes lipid vesicles and promotes cholesterol efflux in cultured macrophages. RG33 Peptide is used in research into type 2 diabetes (T2D) .
|
- HY-P4704
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-95) (human) is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
- HY-P4704A
-
|
|
α-synuclein
|
Neurological Disease
|
|
α-Synuclein (61-95) (human) TFA is the hydrophobic core region of α-synuclein, and induces neuronal cell death. α-Synuclein (61-95) (human) TFA can be used for research of neurodegenerative diseases, including Alzheimer’s disease (AD) and Parkinson’s disease (PD) .
|
- HY-P4116A
-
|
pHLIP TFA
|
Peptides
|
Metabolic Disease
Cancer
|
|
pH-Low Insertion Peptide TFA (pHLIP TFA) is a short, pH-responsive peptide capable of inserting across a cell membrane to form a transmembrane helix at acidic pH. pH-Low Insertion Peptide TFA targets the acidic tumor microenvironment for tumors at early and metastatic stages with high specificity, used as a specific ligand. pH-Low Insertion Peptide TFA successfully modifys polylysine polymers to have the pH-responsive capability. pH-Low Insertion Peptide TFA -based targeting of cancer presents an opportunity to monitor metabolic changes and to selectively deliver imaging and therapeutic agents to tumors .
|
- HY-P1231
-
- HY-P1519
-
|
BNP (1-32), rat
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat (BNP (1-32), rat) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P1519B
-
|
BNP (1-32), rat acetate
|
Angiotensin Receptor
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide (1-32), rat acetate (BNP (1-32), rat acetate) is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes) .
|
- HY-P1064A
-
|
|
HIV
Apelin Receptor (APJ)
|
Infection
Cardiovascular Disease
Metabolic Disease
|
|
Apelin-36(human) TFA is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) TFA shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC550=8.61). Apelin-36(human) TFA has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) TFA inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ .
|
- HY-P1064
-
|
|
Apelin Receptor (APJ)
HIV
|
Infection
Cardiovascular Disease
Metabolic Disease
|
|
Apelin-36(human) is an endogenous orphan G protein-coupled receptor APJ agonist, with an EC50 of 20 nM. Apelin-36(human) shows high affinity to human APJ receptors expressed in HEK 293 cells (pIC50=8.61). Apelin-36 has been linked to two major types of biological activities: cardiovascular and metabolic. Apelin-36(human) inhibits the entry of some HIV-1 and HIV-2 into the NP2/CD4 cells expressing APJ .
|
- HY-P2497
-
|
|
GCGR
|
Neurological Disease
|
|
Exendin (5-39) is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. Exendin (5-39) improves memory impairment in β-amyloid protein-treated rats .
|
- HY-P4113
-
|
|
Peptides
|
Neurological Disease
|
|
TAT-NSF700 Fusion Peptide is a potent N-ethyl-maleimide-sensitive factor (NSF) inhibitor. TAT-NSF700 Fusion Peptide can readily permeate the cell membrane and interact with the intracellular organelle directly .
|
- HY-P4752
-
|
|
Peptides
|
Others
|
|
KWKHGAEIVYKSPVV-{S(GlcNAc-β-D)}-GDTSPRHLSNVK-{K(biotinyl)}-NH2 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5871
-
|
JzTx-XII
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII interacts with the channels by modifying the gating behavior .
|
- HY-P5785
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Heteropodatoxin-2, a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P5982
-
|
|
Phosphatase
|
Neurological Disease
|
|
PTPσ Inhibitor, ISP can bind to recombinant human PTPs and inhibits PTPσ signaling. PTPσ Inhibitor, ISP can penetrate the membrane and relieves the chondroitin sulfate proteoglycan (CSPG)-mediated axonal sprouting inhibition in spinal cord injury model. PTPσ Inhibitor, ISP enhances remyelination in LPC-induced demyelinated spinal cord. PTPσ Inhibitor, ISP also promotes oligodendrocyte progenitor cells (OPCs) migration, maturation, remyelination, and functional recovery in animal models of Multiple Sclerosis (MS) .
|
- HY-P10079
-
- HY-P0007
-
|
Carbocalcitonin
|
Drug Intermediate
|
Metabolic Disease
|
|
Elcatonin (Carbocalcitonin) is a synthetic analog of eel calcitonin. Elcatonin increases bone mineral density, inhibits bone resorption and processes a central analgesic effect .
|
- HY-P5785A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Heteropodatoxin-2 (TFA), a peptides of 30-amino acid, is a heteropodatoxin. Heteropodatoxin-2 blocks Kv4.2 current expressed in Xenopus laevis oocytes in a voltage-dependent manner, with less block at more positive potentials .
|
- HY-P10379
-
|
|
Neuropeptide FF Receptor
|
Others
Neurological Disease
|
|
palm-PrRP31 is a potent dual receptor agonist for both GPR10 (EC50=72 pM) and NPFF-R2. palm-PrRP31 activates downstream signaling pathways through binding to its receptors, GPR10 and NPFF-R2, which results in reduced appetite and increased energy expenditure. Utilizing palm-PrRP31 facilitates the study of the mechanism of action in the nervous system, thereby elucidating the complex biological processes that regulate appetite and energy expenditure .
|
- HY-P10516
-
|
|
DNA/RNA Synthesis
RAD51
|
Cancer
|
|
BRC4 peptide is a specific peptide in BRCA2 protein that interacts with RAD51 protein to help repair broken DNA chains. BRC4 peptide can be used to study DNA repair mechanisms and cancer occurrence .
|
- HY-P5871A
-
|
JzTx-XII TFA
|
Potassium Channel
|
Others
|
|
Jingzhaotoxin-XII (JzTx-XII) TFA is a specific Kv4.1 channel inhibitor with an IC50 of 0.363 μM. Jingzhaotoxin-XII TFA interacts with the channels by modifying the gating behavior .
|
- HY-P1463
-
|
Thyrocalcitonin eel
|
Peptides
|
Endocrinology
|
|
Calcitonin, eel is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis.
|
- HY-P1532
-
- HY-P1463A
-
|
Thyrocalcitonin eel TFA
|
Peptides
|
Others
|
|
Calcitonin, eel TFA is the thyroid hormone peptide that contributes to the regulation of calcium homeostasis, widely used in the research of postmenopausal osteoporosis .
|
- HY-P1222
-
|
|
Bacterial
|
Infection
|
|
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing .
|
- HY-P1833
-
|
|
Peptides
|
Neurological Disease
|
|
Egg Laying Hormone, aplysia is a neuropeptide synthesized by the bag cell neurons, which contains 36 amino acids and can stimulate egglaying and ovulation in Aplysia via electrical discharge triggering of neurons. Egg-laying hormone of Aplysia induces a voltage-dependent slow inward current carried by Na' in an identified motoneuron .
|
- HY-P1222A
-
|
|
Bacterial
|
Infection
|
|
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human TFA could help protect the cornea from infection and modulates wound healing .
|
- HY-P1513A
-
|
|
Bacterial
|
Infection
|
|
LL-37 scrambled peptide acetate is a scrambled version of cathelicidin anti-microbial peptide LL-37. LL-37 scrambled peptide acetate can be used as a negative control of LL-37 peptide studies.
|
- HY-P2283
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-37) (human) correlates moderately with Mini-Mental State Examination (MMSE) scores in Alzheimer disease. β-Amyloid (1-37) (human) possesses an added diagnostic value .
|
- HY-P1424A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Lei-Dab7 TFA is a high affinity, selective KCa2.2 (SK2) channel blocker (Kd=3.8 nM). Lei-Dab7 TFA exhibits >200-fold selectivity for KCa2.2 over KCa2.1, KCa2.3, KCa3.1, Kv and Kir2.1. Lei-Dab7 TFA increases theta-burst responses and increases LTP in rat hippocampal slices in vitro.
|
- HY-P1424
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Lei-Dab7 is a potent and selective SK2 (KCa2.2) channels blocker with a Kd of 3.8 nM. Lei-Dab7 shows low or no activity on KCa1, KCa3, Kv and Kir2.1 channels .
|
- HY-P3769
-
|
|
Guanylate Cyclase
|
Cardiovascular Disease
|
|
Prepro-ANF (56-92), human is a human atrial natriuretic factor precursor. Prepro-ANF (56-92), human is also a guanylate cyclase activator that enhances particulate guanylate cyclase activity in the renal membrane and renal unit .
|
- HY-P4741
-
|
|
Peptides
|
Others
|
|
LL-37 (37-1) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5327
-
|
|
Bcl-2 Family
|
Others
|
|
r8 Bid BH3 is a biological active peptide. (The Bid BH3 is a pro-apoptotic member of the 'BH3-only' subset of BCL-2 family proteins that constitute a critical control point in apoptosis. r8BIDBH3 is lethal to human leukemia cell lines that expresse Bcl-2. The Bcl-2 antagonists may have the potential to be efficacious in cancer therapy. Poly-D-arginine (d-isomer as denoted by rrrrrrrr) is fused to the Bid BH3 peptide to facilitate cellular uptake of the peptide.)
|
- HY-P5836
-
|
|
Interleukin Related
Bacterial
Enterovirus
|
Inflammation/Immunology
|
|
Citrullinated LL-37 1cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 1cit does not alter the antiviral effect of LL-37 toward human rhinovirus. Citrullinated LL-37 1cit shows antibacterial activity toward S. aureus. Citrullinated LL-37 1cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B .
|
- HY-P5837
-
|
|
Interleukin Related
Enterovirus
|
Inflammation/Immunology
|
|
Citrullinated LL-37 2cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 2cit reduces LL-37 activity against HRV at 10 μg/mL and reduces the antibacterial effect of LL-37. Citrullinated LL-37 2cit causes a reduction in the levels of IL-8, CCL5, and IL-6 mRNA induced by RV1B. Citrullinated LL-37 2cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
- HY-P5838
-
|
|
Bacterial
|
Inflammation/Immunology
|
|
Citrullinated LL-37 5cit is a citrullinated LL-37 (HY-P1222) peptide. The antiviral and antibacterial effects of Citrullinated LL-37 5cit are significantly reduced compared to native LL-37. Citrullinated LL-37 5cit is unable to reduce LPS-mediated release of TNF-α due to a lack of LPS-binding capacity .
|
- HY-P5842
-
|
|
Bacterial
Influenza Virus
|
Infection
|
|
Citrullinated LL-37 3cit is a host defense peptide (HDP) with broad immunomodulatory and antimicrobial activities. Citrullinated LL-37 3cit exhibits direct antiviral effects against human rhinoviruses (HRV) .
|
- HY-P5843
-
|
|
Enterovirus
|
Infection
|
|
Citrullinated LL-37 3cit is a citrullinated LL-37 (HY-P1222) peptide. Citrullinated LL-37 3cit lacks all antiviral activity at 10 μg/mL and retains some activity against HRV at 30 μg/mL. Citrullinated LL-37 3cit reduces the immunomodulatory activity of LL-37. Citrullinated LL-37 3cit shows a moderate loss in the ability to reduce HRV-induced CCL5 secretion .
|
- HY-P5873
-
|
JZTX-X
|
Potassium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-X (JZTX-X) is a selective Kv4.2 and Kv4.3 potassium channels inhibitor. Jingzhaotoxin-X causes long-lasting mechanical hyperalgesia .
|
- HY-P5739
-
|
|
Bacterial
|
Infection
|
|
Mram 8 is a cyclotide isolated from Viola philippica, a plant from the Violaceae family .
|
- HY-P5772
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-II, a 32 amino acid residues including two acidic and two basic residues, is a neurotoxin. Jingzhaotoxin-II inhibits voltage-gated sodium channels (VGSC) that significantly slows rapid inactivation of TTX-resistant (TTX-R) VGSC on cardiac myocytes with the IC50 of 0.26 μM .
|
- HY-P5773
-
|
|
Sodium Channel
|
Neurological Disease
|
|
Jingzhaotoxin-34, a 35-residue polypeptide, is a neurotoxin. Jingzhaotoxin-34 inhibits tetrodotoxin-sensitive (TTX-S) sodium currents (IC50 of ~85 nM) while having no significant effects on tetrodotoxin-resistant (TTX-R) sodium currents on rat dorsal root ganglion neurons .
|
- HY-P10377
-
|
|
Neuropeptide FF Receptor
|
Metabolic Disease
|
|
GUB03385 is a long-acting PrRP31 analogue. GUB03385 is a potent dual agonist for GPR10 (full agonist, EC50: 0.4 nM) and NPFF2R (partial agonist, EC50: 20 nM). GUB03385 has anti-obesity effect .
|
- HY-P10380
-
|
|
Neuropeptide FF Receptor
|
Neurological Disease
|
|
palm11-PrRP31 is a lipidized endogenous appetite inhibitory neuropeptide (PrRP) analogue. palm11-PrRP31 is GPR10 (EC50=39 pM) and NPFF-R2 effective dual agonists. palm11-PrRP31 is able to mimic the natural function of PrRP by binding to these receptors to reduce food intake. palm11-PrRP31 can be used as a potential anti-obesity agent and for the study of neuropeptide-receptor interaction .
|
- HY-P10631
-
|
|
HSP
|
Inflammation/Immunology
|
|
Gp96-II is a gp96-blocking peptide that antagonizes gp96-mediated LPS(HY-D1056)-induced cytokine production. Gp96-II can be utilized in research on inflammatory disease .
|
- HY-P1539
-
- HY-P2562
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-38), mouse, rat is composed of 38 aa (1-38 residues of the Aβ peptide) and is the primary component of the amyloid plaques of Alzheimer’s disease .
|
- HY-P3979
-
|
HNP 4
|
Bacterial
|
Infection
|
|
Defensin HNP 4 (HNP 4) is a single 11 amino acid long fragment of HNP-41-11. Defensin HNP 4 has inhibitory effect against multidrug-resistant and non-resistant strains .
|
- HY-P4744
-
|
|
Bacterial
|
Infection
Cancer
|
|
LL-37 amide is a positively charged antimicrobial peptide. LL-37 amide has anticancer activity and can be used for cancer research .
|
- HY-P5076
-
|
|
Peptides
|
Others
|
|
Biotinyl-LL-37 is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P0221B
-
|
|
PACAP Receptor
|
Endocrinology
|
|
PACAP (1-38) free acid TFA is an endogenous neuropeptide. PACAP (1-38) free acid TFA potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid TFA also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
- HY-P0221C
-
|
|
PACAP Receptor
|
Endocrinology
|
|
PACAP (1-38) free acid is an endogenous neuropeptide. PACAP (1-38) free acid potently stimulates antral motility and somatostatin secretion, inhibits the secretion of gastrin and stimulates the release of vasoactive intestinal polypeptide, gastrin releasing peptide and substance P. PACAP (1-38) free acid also enhances N-methyl-D-aspartate receptor function and expression of brain-derived neurotrophic factor through RACK1 .
|
- HY-P3688
-
|
Aβ (1-38); Aβ38
|
Amyloid-β
|
Others
|
|
β-Amyloid (1-38) (Aβ (1-38); Aβ38) is aAβ Fragment.
|
- HY-P4865
-
- HY-P4894
-
- HY-P4885
-
|
AβpE3-40
|
Amyloid-β
|
Neurological Disease
|
|
Glp-Amyloid-β (3-40) Peptide (human) (AβpE3-40) is a minor amounts of pyroglutamate-modified Aβ isolated from from 24-month-old Amyloid precursor protein (APP) transgenic Mice .
|
- HY-P4744A
-
|
|
Bacterial
|
Infection
Cancer
|
|
LL-37 amide TFA is a positively charged antimicrobial peptide. LL-37 amide TFA has anticancer activity and can be used for cancer research .
|
- HY-P10262
-
- HY-P10306
-
|
|
Bacterial
|
Infection
|
|
Cys-LL37 is a biomaterial with antimicrobial properties developed by covalently fixing to the surface of titanium. Cys-LL37 uses a flexible hydrophilic polyethylene glycol spacer and selective n-terminal coupling LL37, a surface peptide layer that kills bacteria on contact is formed. Cys-LL37 can be used in research to develop new antimicrobial biomaterials .
|
- HY-169232
-
|
|
PROTACs
|
Cancer
|
|
PCC16 chloride is a CRBN-based cp-PCC with an IC50 value of 102 nM for the degradation of DHHC3. PCC16 chloride has antitumor activity. (Target protein ligand: HY-169235, linker: HY-169236, E3 ligase ligand: HY-10984) .
|
- HY-P1157
-
- HY-P1211
-
|
1-39-Corticotropin (human)
|
Peptides
|
Metabolic Disease
|
|
Adrenocorticotropic Hormone (ACTH) (1-39), human is a melanocortin receptor agonist.
|
- HY-P0221
-
|
Pituitary Adenylate Cyclase Activating Polypeptide 38
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
- HY-P0221A
-
|
Pituitary Adenylate Cyclase Activating Polypeptide 38 TFA
|
PACAP Receptor
|
Neurological Disease
|
|
PACAP (1-38), human, ovine, rat TFA is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
|
- HY-P1752
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II (human) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior .
|
- HY-P1752A
-
|
|
CRFR
|
Metabolic Disease
Endocrinology
|
|
Urocortin II, human (TFA) is a selective endogenous peptide agonist of type-2 corticotropin-releasing factor (CRF2) receptor. For investigating the role of the CRF (2) receptor in ingestive behavior .
|
- HY-106373
-
|
ACTH; Adrenocorticotrophic hormone
|
Androgen Receptor
|
Endocrinology
|
|
Adrenocorticotropic hormone (ACTH) is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production .
|
- HY-106373A
-
|
ACTH TFA; Adrenocorticotrophic hormone TFA
|
Androgen Receptor
|
Metabolic Disease
|
|
Adrenocorticotropic hormone (ACTH) TFA is a polypeptide tropic hormone produced by the anterior pituitary gland. Adrenocorticotropic hormone regulates cortisol and androgen production .
|
- HY-P4734
-
|
|
Peptides
|
Others
|
|
5-FAM-LL-37 (scrambled) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4459
-
- HY-P5009
-
|
|
Peptides
|
Others
|
|
Copeptin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P1211B
-
|
1-39-Corticotropin (human) (acetate)
|
Biochemical Assay Reagents
|
Others
|
|
Adrenocorticotropic Hormone (ACTH) (1-39), human acetate is a full length human adrenocorticotropic hormone .
|
- HY-107528
-
|
|
β-catenin
GSK-3
|
Cancer
|
|
FRATtide is a peptide derived from the GSK-3 binding protein that inhibits the phosphorylation of Axin and β-catenin. FRATtide inhibits GSK-3 binding to Axin .
|
- HY-P5791
-
- HY-P4868
-
- HY-P4892
-
- HY-P5007
-
|
|
Biochemical Assay Reagents
|
Cardiovascular Disease
|
|
Copeptin (human) is a diagnostic and prognostic biomarker for cardiovascular disease (CVD). Copeptin (human) is also the carboxyl terminus of the arginine vasopressin (AVP) precursor peptide. Copeptin (human) can be used in the study of cardiovascular disease .
|
- HY-P5130
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Big endothelin-1 (rat 1-39) is a 39-residues peptide. Big endothelin-1 (rat 1-39) induces diuretic and natriuretic response in conscious Sprague-Dawley rats. Big endothelin-1 (rat 1-39) raises blood pressure in mice .
|
- HY-P10526
-
|
|
Bacterial
|
Infection
|
|
CRAMP (1-39) is an antimicrobial peptide. CRAMP (1-39) has shown potent bactericidal effects against multiple strains of Neisseria meningitidis in vitro. CRAMP (1-39) can be used to study drug-resistant bacterial infections .
|
- HY-13443
-
- HY-13443A
-
- HY-P0265
-
- HY-P1387
-
|
|
Amyloid-β
Apoptosis
|
Neurological Disease
|
|
β-Amyloid (1-40) (rat) is a rat form of the amyloid β-peptide, which accumulates as an insoluble extracellular deposit around neurons, giving rise to the senile plaques associated with Alzheimer's disease (AD). β-Amyloid (1-40) (rat) increases 45Ca 2+ influx, induces neurodegeneration in the rat hippocampal neurons of the CA1 subfield. β-Amyloid (1-40) (rat) induces apoptosis. β-Amyloid (1-40) (rat) can be used for the research of Alzheimer's disease .
|
- HY-106224
-
|
Hypocretin-1 (human, rat, mouse)
|
Orexin Receptor (OX Receptor)
|
Neurological Disease
|
|
Orexin A (human, rat, mouse) (Hypocretin-1 (human, rat, mouse)), a 33 amino acid excitatory neuropeptide, orchestrates diverse central and peripheral processes. Orexin A (human, rat, mouse) binds and activates two types of G protein-coupled receptors, the orexin-1 receptor (OX1R) and the orexin-2 receptor (OX2R). Orexin A (human, rat, mouse) has a role in the regulation of feeding behavior. Orexin A (human, rat, mouse) is an effective anti-nociceptive and anti-hyperalgesic agent in mice and rats .
|
- HY-P1296
-
|
Urocortin (Rattus norvegicus); Rat urocortin
|
CRFR
|
Neurological Disease
Endocrinology
|
|
Urocortin, rat (Urocortin (Rattus norvegicus)) is a neuropeptide and a potent endogenous CRFR agonist with Kis of 13 nM, 1.5 nM, and 0.97 nM for human CRF1, rat CRF2α and mouse CRF2β, respectively .
|
- HY-P1543
-
- HY-P2282
-
|
|
STAT
|
Cancer
|
|
APTSTAT3-9R, a specific STAT3-binding peptide, inhibits STAT3 activation and downstream signaling by specifically blocking STAT3 phosphorylation. APTSTAT3-9R exerts antiproliferative effects and antitumor activity .
|
- HY-P0265A
-
|
Amyloid Beta-Peptide (1-40) (human) TFA; Amyloid β-Peptide (1-40) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40) TFA is a primary protein in plaques found in the brains of patients with Alzheimer's disease .
|
- HY-P2549
-
- HY-P2550
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled is a FAM fluorescently-labelled?β-Amyloid (1-40) peptide (λex=?492?nm and λem=?518?nm) .
|
- HY-P1427
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Guangxitoxin 1E is a potent and selective blocker of KV2.1 and KV2.2 channels. Guangxitoxin 1E inhibits KV2 with an IC50 of 1-3 nM. KV2 channels underlie delayed-rectifier potassium currents in various neurons .
|
- HY-P2550A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-40), FAM-labeled TFA is a FAM fluorescently-labelled β-Amyloid (1-40) peptide (λex= 492 nm and λem= 518 nm).
|
- HY-P4790
-
|
|
PI3K
Akt
|
Metabolic Disease
|
|
Acetyl-Exenatideyes is an acetylated derivative of Exenatide. Exenatide has the function similar to insulin, which can be used for research of type 2 diabetes. Exenatide can promote Th17 differentiation, inhibits Tregs differentiation, downregulates PI3K/Akt/FoxO1 phosphorylation .
|
- HY-P4614
-
|
|
Peptides
|
Others
|
|
(Lys(Ac)5,8,12,16)-Histone H4 (1-25)-Gly-Ser-Gly-Ser-Lys(biotinyl) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4503
-
- HY-P4886
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) is the precursor of Pyr peptide. Pyroglutamate-modified Aβ (pEAβ) (3-42) is the core of the amyloid template block in Alzheimer's disease. pEAβ(3-42) accelerated the aggregation of Aβ(1-42), while Aβ(1-42) significantly slowed the primary and secondary nucleation of pEAβ(3-42) .
|
- HY-P4929
-
|
|
Peptides
|
Others
|
|
Biotinyl-(Gln1)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4882
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits .
|
- HY-P5154
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin is a selctive blocker of SK2 (Potassium Channel). Tamapin inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-13443F
-
|
|
Peptides
|
Others
|
|
Exendin 4, biotin labeled is a biological active peptide. (Biotin labeled HY-13443)
|
- HY-P2609F
-
|
|
PACAP Receptor
|
Others
|
|
PACAP (1-38), amide, Biotin-labeled is a biological active peptide. (Biotin-labeled HY-P0221)
|
- HY-P5154A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Tamapin TFA is a venom peptide, targeting to small conductance Ca(2+)-activated K(+) (SK) channels. Tamapin TFA is a selctive blocker of SK2 (Potassium Channel). Tamapin TFA inhibits SK channel-mediated currents in pyramidal neurons of the hippocampus. Tamapin TFA can be isolated from the Indian red scorpion (Mesobuthus tamulus) .
|
- HY-P5361
-
|
|
Peptides
|
Others
|
|
β-Amyloid (40-1) is a biological active peptide. (non-toxic reverse fragment Aβ(40–1), control of HY-P0265)
|
- HY-P5368
-
|
|
Peptides
|
Others
|
|
[Arg6]-β-Amyloid (1-40), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.)
|
- HY-P5370
-
|
|
Amyloid-β
|
Others
|
|
Scrambled β-amyloid (1-40) is a biological active peptide. (Aβ (1-40) together with Aβ (1-42) are two major C-terminal variants of the Aβ protein constituting the majority of Aβs. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. This peptide is the scrambled sequence of Abeta 1-40 HY-P0265)
|
- HY-P4882A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Pyr3)-Amyloid β-Protein (3-42) TFA is the predominant amyloid β-peptide structure deposited in human brain of Alzheimer's disease and Down's syndrome patients. (Pyr3)-Amyloid β-Protein (3-42) TFA is suggested to accumulate in the brain and to trigger the formation of insoluble amyloid β-peptide deposits .
|
- HY-P5906
-
|
Citrullinated Aβ (1-40); Citrullinated Aβ40
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-40) peptide (human) (Citrullinated Aβ (1-40)) is a modified form of β-Amyloid (1-40) (HY-P0265) with a citrullination at the Arg5 site. Citrullinated amyloid-β (1-40) peptide (human) exhibits increased transient formation of soluble oligomers and insoluble aggregates composed of distorted parallel β-sheets compared with unmodified β-Amyloid (1-40) .
|
- HY-P4864
-
|
|
Peptides
|
Others
|
|
Biotinyl-ACTH (1-39) (human) is abiotinylated Adrenocorticotropic Hormone (ACTH) (1-39), human (HY-P1211).
|
- HY-P5057
-
- HY-P4889
-
|
|
Peptides
|
Neurological Disease
|
|
(Gly22)-amyloid beta-protein(1-40) (Arctic variant Ab40ARC (E22G)) is a peptide. (Gly22)-amyloid beta-protein(1-40) can be used for the research of Alzheimer's disease .
|
- HY-P5681
-
|
|
Bacterial
|
Infection
Inflammation/Immunology
|
|
Human α-Defensin 6, a 32-residue cysteine-rich peptide, can inhibit bacterial invasion and contribute to the mucosal immunity. Human α-Defensin 6 forms ordered self-assembly fibrils and nanonets that surround and entangle bacteria after stochastic binding to bacterial surface proteins. Human α-Defensin 6 also inhibits C. albicans biofilm formation .
|
- HY-P3397
-
|
|
GHSR
|
Cancer
|
|
JV-1-36 is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
- HY-P2786A
-
- HY-P10040
-
|
|
Peptides
|
Neurological Disease
|
|
(Gln22)β-Amyloid (1-40) human is an amyloid beta protein (Aβ)-containing peptide used in Alzheimer's disease research .
|
- HY-P3397A
-
|
|
GHSR
|
Cancer
|
|
JV-1-36 acetate is a growth hormone-releasing hormone (GHRH) antagonist. JV-1-36 acetate inhibits the production of reactive oxygen species in A549 lung cancer cells. JV-1-36 can be used to study the effect of GHRH antagonists in vitro .
|
- HY-P1427A
-
|
|
Potassium Channel
|
Neurological Disease
|
|
Guangxitoxin 1E TFA is the TFA salt form of Guangxitoxin 1E (HY-P1427). Guangxitoxin 1E TFA is a peptide toxin and a selective inhibitor for voltage-gated potassium channel KV2.1 and KV2.2 with IC50 of 1-3 nM. Guangxitoxin 1E TFA enhances glucose-stimulated intracellular calcium ion oscillations and increases insulin secretion in a glucose-dependent manner .
|
- HY-P4886A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
Amyloid β-Protein (3-42) TFA is a precursor of Pyr peptide. Pyroglutamic acid-modified Aβ (pEAβ) (3-42) is the core of the amyloid plaque in Alzheimer's disease. pEAβ (3-42) accelerates the aggregation of Aβ(1-42), while Aβ(1-42) significantly slows down the primary and secondary nucleation of pEAβ(3-42).
|
- HY-P10745
-
|
ZP8396
|
Amylin Receptor
|
Metabolic Disease
|
|
Petrelintide (ZP8396) is an amylin analogue that shows potential to reduce body weight. Petrelintide can be utilized in diabetes research .
|
- HY-P5057B
-
|
|
Fluorescent Dye
Bacterial
|
Infection
|
|
5-FAM-Ahx-LL-37 TFA is a 5-FAM (HY-66022) labeled LL-37, human (HY-P1222). The carboxyfluorescein group is attached via a 6-carbon spacer, 6-Aminohexanoic acid (Ahx, HY-B0236). LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity .
|
- HY-P5057A
-
|
|
Fluorescent Dye
Bacterial
|
Infection
|
|
5-FAM-LL-37 TFA is the TFA salt form of 5-FAM-LL-37 (HY-P5057). 5-FAM-LL-37 TFA is a LL-37 peptide labeled with fluorescein, which retains the antibacterial and immunomodulatory activities of LL-37. 5-FAM-LL-37 TFA binds to the bacterial cell membrane, destroys the integrity of the membrane, and exhibits board-spectrum antibacterial efficacy .
|
- HY-P1242B
-
|
|
Drug Derivative
|
Inflammation/Immunology
|
|
NEP(1-40), N-terminal uncapped is a NEP(1-40) (HY-P1242) analog without the acetylation modification at the N-terminal. NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide .
|
- HY-P1362
-
|
Amyloid β Peptide (42-1)(human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (42-1), human is the inactive form of Amyloid β Peptide (1-42). Its active form, β-Amyloid (1-42), may play a key role in the pathogenesis of Alzheimer's disease .
|
- HY-P1363
-
|
Amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
- HY-P1388
-
|
Amyloid β-peptide (1-42) (rat/mouse)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
- HY-P1388A
-
|
Amyloid β-peptide (1-42) (rat/mouse) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), (rat/mouse) TFA is a 42-aa peptide, shows cytotoxic effect on acute hippocampal slices, and used in the research of Alzheimer's disease.
|
- HY-P1767
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Prepro VIP (81-122), human is a prepro-vasoactive intestinal polypeptide (VIP) derived peptide, corresponding to residues 81-122. Peptide histidine valine 42 (PHV-42) has been designated to correspond exactly to Prepro VIP (81-122), which reduces both the force and frequency of spontaneous contractions of isolated rat uterus .
|
- HY-P1242A
-
|
|
Peptides
|
Inflammation/Immunology
|
|
NEP(1-40) TFA is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition .
|
- HY-P1242
-
|
|
ROCK
|
Inflammation/Immunology
|
|
NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition .
|
- HY-P1378
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
- HY-P1378A
-
|
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-43)(human) TFA is more prone to aggregation and has higher toxic properties than the long-known Aβ1-42. β-Amyloid (1-43)(human) TFA shows a correlation with both sAPPα and sAPPβ. β-Amyloid (1-43)(human) TFA could be considered an added Alzheimer's disease (AD) biomarker together with the others already in use .
|
- HY-P2315
-
|
HβD-1
|
Antibiotic
Bacterial
|
Infection
|
|
Human β-defensin-1 (HβD-1) is a cysteine-rich cationic skin-antimicrobial peptide (SAP) produced by all epithelial surfaces, but also by circulatory cells and cells of the reproductive tract. Human β-defensin-1 has antimicrobial activities against a broad-sperm bacteria .
|
- HY-P0265AS
-
|
Amyloid Beta-Peptide-15N (1-40) (human) TFA; Amyloid β-Peptide-15N (1-40) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid- 15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].
|
- HY-P4398
-
|
|
Peptides
|
Others
|
|
(Cys(Acm)6,12)-Orexin A (human, mouse, rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4657
-
|
|
Peptides
|
Endocrinology
|
|
Human Growth Hormone (1-43) is an N-terminal fragment of human growth hormone with specific and pronounced insulin-like activity. Human Growth Hormone (1-43) can be used to study the function and metabolic pathways of growth hormone, a potential obesity-related factor .
|
- HY-P4585
-
|
|
Amyloid-β
|
Neurological Disease
|
|
(Gln22)-Amyloid β-Protein (1-42) is a Dutch mutation (E22Q) form of β-Amyloid (1-42) (HY-P1363). (Gln22)-Amyloid β-Protein (1-42) exhibits enhanced fibrillogenic and pathogenic properties .
|
- HY-P4391
-
- HY-P4753
-
|
|
Peptides
|
Others
|
|
Met(O)14-Exenatide is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4640
-
- HY-P5285
-
|
|
Parasite
|
Infection
Inflammation/Immunology
Cancer
|
|
Lunasin is a bioactive peptide with antioxidant, anti-inflammatory, anticancer and anti-aging properties. Lunasin can be isolated from soybean. Lunasin also has an epigenetic mechanism of action associated with histone acetylation. Lunasin can be internalized into cells and inhibit Oncosphere formation in cancer cells .
|
- HY-P5160
-
|
PhlTx1
|
Sodium Channel
|
Inflammation/Immunology
|
|
Phlotoxin-1 (PhlTx1) is a 34-amino acid and 3-disulfide bridge peptide. Phlotoxin-1 can be isolated from Phlogiellus genus spider. Phlotoxin-1 is an antinociceptive agent by inhibiting NaV1.7 channel .
|
- HY-P0265F
-
|
|
Peptides
|
Others
|
|
Biotin-Ahx-β-Amyloid (1-40) is a biological active peptide. (Biotin labled HY-P0265)
|
- HY-P5369
-
|
|
Peptides
|
Others
|
|
[Arg6]-β-Amyloid (1-42), england mutation is a biological active peptide. (Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds.Tthe English (H6R) mutation will disrupt H6 interactions.)
|
- HY-P1363F1
-
|
Biotin-amyloid β-peptide (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
Biotin-β-Amyloid (1-42), human TFA (Biotin-Amyloid β-Peptide (1-42) (human) TFA) is the botin labeled β-Amyloid (1-42), human TFA (HY-P1363). β-Amyloid (1-42), human TFA is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
- HY-P2699
-
|
GrTx; ω-GsTx SIA
|
Calcium Channel
|
Neurological Disease
|
|
ω-Grammotoxin SIA (GrTx) is P/Q and N-type voltage-gated Calcium channels inhibitor. ω-Grammotoxin SIA is also a protein toxin that can be obtained from spider venom. ω-Grammotoxin SIA has the potential to study neurological diseases as well as cardiovascular diseases .
|
- HY-P5905
-
|
Citrullinated Aβ (1-42); Citrullinated Aβ42
|
Amyloid-β
|
Neurological Disease
|
|
Citrullinated amyloid-β (1-42) peptide (human) (Citrullinated Aβ (1-42)) is a modified form of β-Amyloid (1-42) (HY-P1363) with a citrullination at the Arg5 site. Compared to the unmodified β-Amyloid (1-42), its formation of soluble low-molecular-weight oligomers is enhanced, the rate of fibril formation is reduced, and like unmodified Aβ42, it forms protofibrils comprised of parallel β-sheets .
|
- HY-P4867
-
|
|
Amyloid-β
|
Others
|
|
β Amyloid (1-42) (scrambled) is acontrol of β-Amyloid (1-42), human TFA (HY-P1363).
|
- HY-P5603
-
|
BNBD-12
|
Bacterial
|
Infection
|
|
Bovine neutrophil beta-defensin 12 is an antimicrobial peptide derived from bovine neutrophils, which has antibacterial activity against Escherichia coli and Staphylococcus aureus .
|
- HY-P5628
-
|
|
Bacterial
|
Infection
|
|
Termicin is an antimicrobial peptide from Pseudacanthotermes spiniger. Termicin has anti-gram-positive bacteria, filamentous fungi and yeast activity .
|
- HY-P5780
-
|
|
Sodium Channel
|
Neurological Disease
|
|
π-TRTX-Hm3a is a 37-amino acid peptide isolated from Togo starburst tarantula (Heteroscodra maculata) venom. π-TRTX-Hm3a pH-dependently inhibits acid-sensing ion channel 1a (ASIC1a) with an IC50 of 1-2 nM and potentiates ASIC1b with an EC50 of 46.5 nM .
|
- HY-P4878
-
|
|
Peptides
|
Neurological Disease
|
|
5-TAMRA-Amyloid β-Protein (1-40) is a fluorescent (TAMRA)-labeled Amyloid β-Protein (1-40), Abs/Em=544/572 nm .
|
- HY-P10026
-
|
LY-3457263
|
Peptides
|
Metabolic Disease
|
|
Nisotirotide (LY-3457263) is a PYY analog agonist studied in type 2 diabetes and obesity .
|
- HY-P3684A
-
|
|
CRFR
|
Neurological Disease
|
|
[DPro5] Corticotropin Releasing Factor, human, rat TFA is a selective corticotropin releasing factor/hormone R2 (CRH-R2)agonist. [DPro5] Corticotropin Releasing Factor, human, rat TFA fails to cause the typical anxiogenic effect, but modulates learning and memory processes in rat .
|
- HY-P10093
-
|
|
PI3K
|
Others
|
|
Penetratin-PI3Kγ(126-150) is a peptide inhibitor of ΡI3Κγ that plays an important role in respiratory system diseases .
|
- HY-P10255
-
|
|
Potassium Channel
|
Cancer
|
|
K90-114TAT is an inhibitor for EAG2-Kvβ2 interaction, and exhibits antitumor efficacy against glioblastomas .
|
- HY-P10341
-
|
|
GCGR
|
Metabolic Disease
|
|
ZP3022 is a dual agonist of glucagon-like peptide-1 (GLP-1) and gastrin that has the ability to sustainably improve glycemic control. Additionally, ZP3022 can effectively increase β-cell mass, promote β-cell proliferation, and enhance the function of pancreatic islets. ZP3022 can be used in anti-diabetic research .
|
- HY-P10381
-
|
|
Peptides
|
Others
|
|
palm11-TTDS-PrRP31 is a strong agonist of GPR10 (EC50: 84 pM). palm11-TTDS-PrRP31 has long-lasting anorexigenic effects .
|
- HY-P1363A
-
|
Amyloid β-peptide (1-42) (human)
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid (1-42), human (Amyloid β-peptide (1-42), human) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease .
|
- HY-P10378
-
|
|
GnRH Receptor
|
Metabolic Disease
|
|
GPR10 agonist 1 (compound 18-S4) is a potent GPR10 agonist with EC50 values of 80, 7.8 nM in the presence (10%) or absence (0%) of FBS, respectively. GPR10 agonist 1 has the potential for the research of chronic obesity .
|
- HY-P10487
-
|
|
Amyloid-β
|
Neurological Disease
|
|
APP669-711 is a peptide segment from amino acid 669 to amino acid 711 of amyloid precursor protein (APP). APP669-711 can be used to diagnose the amyloid deposition in the brain, and is a biomarker for Alzheimer's disease (AD) research .
|
- HY-P1457
-
|
|
Peptides
|
Cardiovascular Disease
|
|
Adrenomedullin (AM) (13-52), human is a 40 amino acid peptide, which acts as an endothelium-dependent vasodilator agent.
|
- HY-P0119
-
|
|
GCGR
MEK
Akt
MMP
JNK
|
Neurological Disease
Metabolic Disease
Inflammation/Immunology
|
|
Lixisenatide is a GLP-1 receptor agonist. Lixisenatide inhibits the inflammatory response through down regulation of proinflammatory cytokines, and blocks of cellular signaling pathways. Lixisenatide decreases atheroma plaque size and instability in Apoe −/− Irs 2+/− mice by reprogramming macrophages towards an M2 phenotype, which leads to reduced inflammation .
|
- HY-P1766
-
|
|
CGRP Receptor
|
Cardiovascular Disease
|
|
Adrenomedullin (11-50), rat is the C-terminal fragment (11-50) of rat adrenomedullin. Rat adrenomedullin induces a selective arterial vasodilation via CGRP1 receptors .
|
- HY-P1078
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Huwentoxin XVI, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P1078A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
Huwentoxin XVI TFA, an analgesic, is a highly reversible and selective mammalian N-type calcium channel (IC50 of ~60 nM) antagonist from Chinese tarantula Ornithoctonus huwena. Huwentoxin XVI TFA has no effect on voltagegated T-type calcium channels, potassium channels or sodium channels .
|
- HY-P2538
-
- HY-P2539
-
|
|
Vasopressin Receptor
|
Cardiovascular Disease
|
|
Big Endothelin-1 (1-39), porcine is the precursor of endothelin-1. Endothelin-1 (ET-1) is a potent vasopressor peptide. Big Endothelin-1 (1-39), porcine has similar pressor effects in vivo .
|
- HY-P1363S
-
|
Amyloid β-peptide-15N (1-42) (human) TFA
|
Amyloid-β
|
Neurological Disease
|
|
β-Amyloid- 15N (1-42), human (TFA) is the 15N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].
|
- HY-P4912
-
|
|
Peptides
|
Others
|
|
Big Endothelin-1 (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P5096
-
|
|
Peptides
|
Others
|
|
FITC-β-Ala-Amyloid β-Protein (1-42) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4211
-
|
|
Bacterial
|
Infection
|
|
PSM-β is a active peptide , which can be isolated from Staphylococcus epidermidis. PSM-β is an analog of staphylococcal toxins, as well as a termed phenol-soluble modulin. PSM-β has bacteriostatic and poorly hemolytic properties .
|
- HY-P5161A
-
|
|
GCGR
|
Metabolic Disease
|
|
FC382K10W15 TFA is a glucagon analogue and GLP-1R/GCGR agonist. FC382K10W15 TFA can be used in type 2 diabetes research .
|
- HY-P5161
-
- HY-P4861
-
|
|
Amyloid-β
|
Others
|
|
Biotinyl-Ahx-Amyloid β-Protein (1-42) is abiotinylated β-Amyloid (1-42), human (TFA) (HY-P1363).
|
- HY-P3014
-
|
|
Potassium Channel
|
Others
|
|
Hongotoxin-1, isolated from venom of Centruroides limbatus, is the inhibitor of potassium channel, with IC50 for? Kv1.1, Kv1.2, Kv1.3, and Kv1.6 of 31 pM, 170 pM, 86 pM,and 6000 pM, respectively .
|
- HY-P5624
-
|
|
Bacterial
|
Infection
|
|
Gallin is an antimicrobial peptide derived from egg whites. Gallin inhibits the growth of Escherischia coli at 0.25 μM concentration .
|
- HY-P5738
-
|
|
Bacterial
|
Infection
|
|
Palicourein is a 37 amino acid cyclic polypeptide. Palicourein inhibits the in vitro cytopathic effects of HIV-1RF infection of CEM-SS cells with an EC50 value of 0.1 μM and an IC50 value of 1.5 μM .
|
- HY-P1363F3
-
|
5-FAM-Amyloid β-peptide (1-42) (human) Tris
|
Amyloid-β
|
Others
|
|
5-FAM-β-Amyloid (1-42), human (5-FAM-Amyloid β-peptide (1-42) (human) TFA is a5-FAM labeled β-Amyloid (1-42), human TFA (HY-P1363).
|
- HY-P10271
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
RG7697 is a dual agonist for glucagon-like peptide receptor (GLP Receptor) and glucosedependent insulinotropic polypeptide receptor (GIPR), with EC50 of 5 and 3 pM, respectively. RG7697 exhibits antihyperglycemic property .
|
- HY-P2656
-
|
hBD-4
|
Bacterial
|
Infection
|
|
β-Defensin-4 human is an inducible peptide with a specific salt-sensitive spectrum of antimicrobial activity .
|
- HY-P10302
-
|
|
GLP Receptor
Insulin Receptor
|
Metabolic Disease
|
|
GLP-1R/GIPR AgonIST-1 is a double-receptor agonist for GLP-1 (glucagon-like peptide-1) and GIP (glucose-dependent insulin releasing peptide). GLP-1R/GIPR agonist-1 lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
- HY-P10302A
-
|
|
GLP Receptor
|
Metabolic Disease
|
|
GLP-1R/GIPR agonist-1 soduim is the sodium salt form of GLP-1R/GIPR agonist-1 (HY-P10302). GLP-1R/GIPR agonist-1 soduim is a dual agonist for glucagon-like peptide-1 receptor (GLP-1R, EC50 is 0.57 nM) and glucose-dependent insulin releasing peptide receptor (GIPR, EC50 is 0.75 nM). GLP-1R/GIPR agonist-1 soduim lowers blood sugar by mimicking the action of endogenous hormones GLP-1 and GIP, enhancing insulin secretion while inhibiting glucagon secretion. GLP-1R/GIPR agonist-1 soduim can be used in the study of metabolic diseases such as diabetes, obesity, and non-alcoholic steatohepatitis (NASH) .
|
- HY-P1346A
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2 TFA, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P1346
-
|
|
Sodium Channel
|
Neurological Disease
Inflammation/Immunology
|
|
APETx2, a sea anemone peptide from Anthopleura elegantissima, is a selective and reversible ASIC3 inhibitor, with an IC50 of 63 nM. APETx2 directly inhibits the ASIC3 channel by acting at its external side. APETx2 could reverses acid‐induced and inflammatory pain .
|
- HY-P1074
-
|
|
Calcium Channel
|
Neurological Disease
|
|
SNX-482, a peptidyl toxin of the spider Hysterocrates gigas, is a potent, high affinity, selective and voltage-dependent R-type CaV2.3 channel blocker with an IC50 of 30 nM. SNX-482 has antinociceptive effect .
|
- HY-P3255
-
- HY-P4395
-
|
|
Peptides
|
Others
|
|
(Asp76)-pTH (39-84) (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4860
-
|
|
Akt
Gli
JNK
PKA
|
Metabolic Disease
|
|
Adropin (34-76) is a secretory domain of Adropin. Adropin (34-76) can inhibit cAMP level and glucose production in hepatocytes, and has a hypoglycemic effect. Adropin (34-76) plays an antifibrotic role by inhibiting the GLI1 signaling pathway .
|
- HY-P4884
-
- HY-P6013
-
|
|
Calcium Channel
|
Others
|
|
wt hMLN is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
- HY-P10230
-
|
|
Bacterial
|
Infection
|
|
Sublancin is an antimicrobial peptide, which inhibits DNA replication, transcription and translation, without affecting membrane integrity. Sublancin suppresses glucose uptake for the competition of phosphotransferase system (PTS). Sublancin inhibits B. subtilis strain 168 ΔSPβ with MIC of 0.312 μM .
|
- HY-P10591
-
|
Olatorepatidum
|
Insulin Receptor
GLP Receptor
|
Metabolic Disease
|
|
Olatorepatide (Olatorepatidum) is a dual gastric inhibitory polypeptide (GIP) receptor and glucagon like peptide 1 (GLP-1) receptor agonist, with antidiabetic effect .
|
- HY-P1573
-
|
BNP-45, rat
|
Peptides
|
Cardiovascular Disease
|
|
Brain Natriuretic Peptide-45, rat (BNP-45, rat) is a circulating form of rat brain natriuretic peptide isolated from rat heart with potent hypotensive and natriuretic potency .
|
- HY-P1411
-
|
PcTx1; Psalmopoeus cambridgei toxin-1
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
|
Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease .
|
- HY-P1573A
-
- HY-P4975
-
|
|
Peptides
|
Others
|
|
CART (61-102) (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P6013A
-
|
|
Peptides
|
Others
|
|
wt hMLN (TFA) is a microprotein that inhibits of SR Ca 2+ pump (SERCA). wt hMLN plays an important role in skeletal muscle calcium homeostasis .
|
- HY-P1411A
-
|
PcTx1 TFA; Psalmopoeus cambridgei toxin-1 TFA
|
Sodium Channel
Apoptosis
|
Neurological Disease
Cancer
|
|
Psalmotoxin 1 (PcTx1) TFA is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 TFA is a potent and slective ASIC1a inhibitor (IC50: 0.9 nM) by increasing the apparent affinity for H + of ASIC1a. Psalmotoxin 1 TFA can induce cell apoptosis, also inhibits cell migration, proferliration and invasion of cancer cells. Psalmotoxin 1 TFA can be used in the research of cancers, or neurological disease .
|
- HY-P1607
-
- HY-P4587
-
|
|
Peptides
|
Metabolic Disease
|
|
(Glu13,17,20)-Osteocalcin (1-46) (mouse) is an analogue of Osteocalcin (1-46). Osteocalcin (1-46) is a osteoblast specific peptide involved in the regulation of energy metabolism .
|
- HY-P4723
-
|
|
Peptides
|
Others
|
|
Intermedin (human) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P4728
-
|
|
Peptides
|
Others
|
|
Intermedin (rat) is a polypeptide that can be found by peptide screening. Peptide screening is a research tool that pools active peptides primarily by immunoassay. Peptide screening can be used for protein interaction, functional analysis, epitope screening, especially in the field of agent research and development .
|
- HY-P3384
-
|
|
Antibiotic
|
Others
Inflammation/Immunology
|
|
Pezadeftide is a potent antifungal peptide. Pezadeftide can enter fungal cells and cause a rapid mitochondrial response that results in hyperpolarization of the mitochondrial membrane .
|
- HY-P1305A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(rat) TFA is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) TFA is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) TFA can induces anxiety and stress-related behavior .
|
- HY-P1304A
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(human) TFA is a human satiety factor with potent appetite-suppressing activity. CART(55-102)(human) TFA is closely associated with leptin and neuropeptide Y .
|
- HY-P1304
-
- HY-P1305
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior .
|
- HY-P2588
-
|
|
Peptides
|
Inflammation/Immunology
Cancer
|
|
Osteocalcin (human) is a vitamin K-dependent bone specific protein. Osteocalcin (human) is chemotactic for several of the cell types frequently found at bone remodeling surfaces .
|
- HY-P4588
-
|
|
Peptides
|
Metabolic Disease
|
|
(Glu17,21,24)-Osteocalcin (1-49) (human) is a bone-specific protein involved in bone formation and glucose metabolism .
|
- HY-P5754B
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 acetate is a therapeutic candidate for axonal regeneration and functional recovery after stroke. TAT-NEP1-40 acetate can protect PC12 cells against oxygen and glucose deprivation (OGD) and promote neurite outgrowth. TAT-NEP1-40 acetate protects the brain against ischemia/reperfusion injury through inhibition of neuronal apoptosis. TAT-NEP1-40 acetate can be efficiently delivered into the rat brains .
|
- HY-P5754
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 is a BBB-penatrable peptide. TAT-NEP1-40 protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P5754A
-
|
|
Apoptosis
|
Neurological Disease
|
|
TAT-NEP1-40 TFA is a BBB-penatrable peptide. TAT-NEP1-40 TFA protects PC12 cells against oxygen and glucose deprivation (OGD), and promotes neurite outgrowth. TAT-NEP1-40 TFA also improves ischemia-induced neurologic outcomes by inhibiting cell apoptosis in ischemic brains. TAT-NEP1-40 TFA can be used for research of CNS injuries, such as axonal regeneration and functional recovery after stroke .
|
- HY-P10126
-
|
|
Peptides
|
Others
|
|
Osteocalcin, bovine is a vitamin K-dependent bone specific protein. Osteocalcin, bovine is also known as bone gamma-carboxyglutamic acid-containing protein (BGLAP). Osteocalcin, bovine is a small (49-amino-acid) noncollagenous protein hormone .
|
- HY-P1080
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin IVA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA has no effect on L-type or N-type calcium channels .
|
- HY-P1080A
-
|
|
Calcium Channel
|
Neurological Disease
|
|
ω-Agatoxin IVA TFA is a potent, selective P/Q type Ca 2+ (Cav2.1) channel blocker with IC50s of 2 nM and 90 nM for P-type and Q-type Ca 2+ channels, respectively. ω-Agatoxin IVA TFA (IC50, 30-225 nM) inhibits glutamate exocytosis and calcium influx elicited by high potassium. ω-Agatoxin IVA TFA also blocks the high potassium-induced release of serotonin and norepinephrine. ω-Agatoxin IVA TFA has no effect on L-type or N-type calcium channels .
|
- HY-P4976
-
- HY-P5954
-
|
|
Calcium Channel
|
Others
|
|
PLTX-II is a calcium channel blocker. PLTX-II has a 44-residue peptide containing ten Cys residues and an O-palmitoylated threonine amide at the carboxy-terminus .
|
- HY-P5063
-
|
|
Neuropeptide Y Receptor
|
Metabolic Disease
|
|
Galanin-Like Peptide (human) is a 60 amino acid neuropeptide. Galanin-Like Peptide (human) plays an important role in the regulation of feeding, body weight and energy metabolism .
|
- HY-P5064
-
|
|
Neuropeptide Y Receptor
|
Neurological Disease
|
|
Galanin-Like Peptide (porcine) is a 60 amino acid neuropeptide that was first isolated from the porcine hypothalamus. Galanin-Like Peptide (porcine) has a high affinity for the GALR2 receptor (IC50 of 0.24 nM) and a lower affinity for the GALR1 receptor (IC50 of 4.3 nM) .
|
- HY-108905
-
|
Human IGF-I; FK 780
|
IGF-1R
|
Metabolic Disease
|
|
Mecasermin (Human IGF-I; FK 780) is a recombinant human insulin-like growth factor I (IGF-I). Mecasermin has the potential for the study of the growth failure of growth hormone (GH) insensitivity caused by GH receptor defects or GH-inhibiting antibodies .
|
- HY-P4815
-
|
|
Endogenous Metabolite
|
Neurological Disease
Metabolic Disease
|
|
Prokineticin 2 Isoform 2 (human) is a hypothalamic neuropeptide. Prokineticin 2 Isoform 2 (human) decreases food intake and involves in thermoregulation and energy metabolism in rodents. Prokineticin 2 has the potential for the research of hyperglycemia, metabolic syndrome (MetS) and obesity .
|
- HY-P3103
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
PINT-87aa, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa suppresses glioblastoma cell proliferation in vitro and in vivo .
|
- HY-P3103A
-
|
|
DNA/RNA Synthesis
|
Cancer
|
|
PINT-87aa TFA, an 87-amino acid (aa) peptide, is encoded by the circular form of the long intergenic non-protein-coding RNA p53-induced transcript (LINC-PINT). PINT-87aa TFA directly interacts with polymerase associated factor complex (PAF1c) and inhibits the transcriptional elongation of multiple oncogenes. PINT-87aa TFA suppresses glioblastoma cell proliferation in vitro and in vivo .
|
| Cat. No. |
Product Name |
Target |
Research Area |
| Cat. No. |
Product Name |
Category |
Target |
Chemical Structure |
| Cat. No. |
Product Name |
Chemical Structure |
-
- HY-N0667S2
-
|
|
|
L-Asparagine- 15N2 (monohydrate) is the 15N-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S4
-
|
|
|
L-Asparagine-4- 13C (monohydrate) is the 13C-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S3
-
|
|
|
L-Asparagine- 13C4 (monohydrate) is the 13C-labeled L-Asparagine. L-Asparagine ((-)-Asparagine) is a non-essential amino acid that is involved in the metabolic control of cell functions in nerve and brain tissue.
|
-
-
- HY-N0667S7
-
|
|
|
L-Asparagine-13C4,15N2 ((-)-Asparagine-13C4,15N2) is the 13C and 15N-labeled L-Aspartic acid. L-Aspartic acid is an amino acid, shown to be a suitable pro-agent for colon-specific drug delivery .
|
-
-
- HY-W002327S
-
|
|
|
Fmoc-Asn(Trt)-OH- 13C4, 15N2 is a 15N-labeled and 13C-labled 4-(4-(tert-Butyl)-2-ethoxyphenyl)-2-(2,6-difluorophenyl)-4,5-dihydrooxazole[1].
|
-
-
- HY-158992S
-
|
|
|
SP-(Val- 13C5, 15)-EKNQ-(Leu- 13C6, 15)-TIDFINIVKDPVPHNEYKT TFA is a 13C- and 15N-labeled peptide containing 13C5, 15N-labeled valine (Val) and 13C6, 15N-labeled leucine (Leu).
|
-
-
- HY-P2625S1
-
|
|
|
GLP-2(3-33) (Leu- 13C6, 15N) TFA is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
-
- HY-P2625S
-
|
|
|
GLP-2(3-33) (Leu- 13C6, 15N) is 13C and 15N labeled GLP-2(3-33) (HY-P2625). GLP-2(3-33), generated naturally by dipeptidylpeptidase IV (DPPIV), acts as a partial agonist on GLP-2 receptor (EC50=5.8 nM).
|
-
-
- HY-P1142S1
-
|
|
|
GLP-2(rat) (Ala- 13C3, 15N) TFA is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
-
- HY-P1142S
-
|
|
|
GLP-2(rat) (Ala- 13C3, 15N) is 13C and 15N labeled GLP-2(rat) (HY-P1142). GLP-2(rat) is an intestinal growth factor. GLP-2(rat) stimulates cell proliferation and inhibits apoptosis. GLP-2(rat) enhances mucosal mass and function in residual small intestine after massive small bowel resection (MSBR).
|
-
-
- HY-163425S
-
|
|
|
AILNYVANK-(Lys- 13C6, 15N2) is 13C and 15N labeled AILNYVANK-(Lys) .
|
-
-
- HY-156343S1
-
|
|
|
SNNYATHYAESVK-(Lys- 13C6, 15N2) (TFA) is the peptide containing 13C- and 15N-labeled Lys.
|
-
-
- HY-159192S
-
|
|
|
SADDNIKTPAE(Arg- 13C6, 15N4)LLGPLPPSADDNLKT (TFA) is the 13C and 15N labeled isotope of SADDNIKTPAE-LLGPLPPSADDNLKT (TFA) .
|
-
-
- HY-P0090S
-
|
|
|
Calcitonin- 13C6, 15N4 (salmon) (Salmon calcitonin- 13C6, 15N4) TFA is 13C and 15N-labeled Calcitonin (salmon) (HY-P0090). Calcitonin (salmon) , a calcium regulating hormone, is a dual-action amylin and calcitonin receptor agonist, could stimulate bone formation and inhibit bone resorption .
|
-
-
- HY-159064S
-
|
|
|
DSPSAPVNVT(Val- 13C5, 15)R TFA is the 13C and 15N-labeled DSPSAPVNVT(Val)R. Radioactive isotopes labeled compounds can be used in metabolic analysis, allowing the movement of individual atoms to be precisely tracked and quantified .
|
-
-
- HY-159046S
-
|
|
|
ASGITFSNSGMHW(Val-13C5,15N)R TFA is an isotope of ASGITFSNSGMHWVR TFA labeled with 13C and 15N .
|
-
-
- HY-163427S
-
|
|
|
FNLEALVTHTLPFEK-(Lys- 13C6, 15N2) is 13C and 15N labeled FNLEALVTHTLPFEK-(Lys) .
|
-
-
- HY-159191S
-
|
|
|
VQPGQN(Phe- 13C9, 15N)HMFTKEKLEEVIKDI (TFA) is the 13C and 15N labeled isotope of VQPGQN-HMFTKEKLEEVIKDI (TFA) .
|
-
-
- HY-P0265AS
-
|
|
|
β-Amyloid- 15N (1-40) (TFA) is the 15N-labledβ-Amyloid (1-40) (TFA). β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease[1].
|
-
-
- HY-P1363S
-
|
|
|
β-Amyloid- 15N (1-42), human (TFA) is the 15N-labledβ-Amyloid (1-42) (TFA). β-Amyloid (1-42), human TFA (Amyloid β-Peptide (1-42) (human) TFA) is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease[1].
|
-
| Cat. No. |
Product Name |
|
Classification |
-
- HY-141150
-
|
|
|
Azide
ADC Synthesis
|
|
Azido-PEG5-Ala-Ala-Asn-PAB is a cleavable 5 unit PEG ADC linker used in the synthesis of antibody-drug conjugates (ADCs) . Azido-PEG5-Ala-Ala-Asn-PAB is a click chemistry reagent, it contains an Azide group and can undergo copper-catalyzed azide-alkyne cycloaddition reaction (CuAAc) with molecules containing Alkyne groups. It can also undergo strain-promoted alkyne-azide cycloaddition (SPAAC) reactions with molecules containing DBCO or BCN groups.
|
-
- HY-151829
-
|
|
|
Azide
|
|
Fmoc-L-Asn(EDA-N3)-OH is a click chemistry reagent containing an azide group. This building block is reported in literature for the modification of Amanitin via Click Chemistry. Alpha-Amanitin is the deadliest member of the amatoxin peptide family produced by the death-cap mushroom A. phalloides. It is an orally available, rigid, bicyclic octapeptide and one of the most lethal known natural products (LD50 = 50-100 μg/kg) acting as highly selective allosteric inhibitor of the RNA polymerase II . It contains an azide group and can undergo copper-catalyzed azide-alkyne cycloaddition (CuAAc) with molecules containing alkyne groups. It can also undergo ring strain-promoted alkyne-azide cycloaddition (SPAAC) with molecules containing DBCO or BCN groups.
|
| Cat. No. |
Product Name |
|
Classification |
Your information is safe with us. * Required Fields.
Inquiry Information
- Product Name:
- Cat. No.:
- Quantity:
- MCE Japan Authorized Agent:
![[D-Asn5]-Oxytocin](http://file.medchemexpress.eu/product_pic/hy-p3220.gif)
![[Asn18] Endothelin-1, human](http://file.medchemexpress.eu/product_pic/hy-p3615.gif)
![[Nle8] Somatostatin (1-28)](http://file.medchemexpress.eu/product_pic/hy-p3899.gif)
![[Nle8] Somatostatin (1-28) (TFA)](http://file.medchemexpress.eu/product_pic/hy-p3899a.gif)
![[D-Ala2]-GIP (human)](http://file.medchemexpress.eu/product_pic/hy-p3247.gif)
![[Tyr22] Calcitonin Gene Related Peptide, (22-37), rat](http://file.medchemexpress.eu/product_pic/hy-p3689.gif)
![[Leu31,Pro34]-Neuropeptide Y (human,rat)](http://file.medchemexpress.eu/product_pic/hy-p1323.gif)
![[Leu31,Pro34]-Neuropeptide Y(human,rat,mouse) TFA](http://file.medchemexpress.eu/product_pic/hy-p1323a.gif)
![[Leu31,Pro34]-Neuropeptide Y (porcine)](http://file.medchemexpress.eu/product_pic/hy-p0208.gif)
![[Pro34]Neuropeptide Y, porcine](http://file.medchemexpress.eu/product_pic/hy-p10291.gif)
![[D-His26]-Neuropeptide Y, human, rat](http://file.medchemexpress.eu/product_pic/hy-p10545.gif)
![[D-Arg25]-Neuropeptide Y (human)](http://file.medchemexpress.eu/product_pic/hy-p0198b.gif)
![[Pro3]-GIP (mouse)](http://file.medchemexpress.eu/product_pic/hy-p1434.gif)
![[Ala28]-β Amyloid(25-35)](http://file.medchemexpress.eu/product_pic/hy-p5968.gif)
![D[LEU4,LYS8]-VP TFA](http://file.medchemexpress.eu/product_pic/hy-p1163a.gif)
![D[LEU4,LYS8]-VP](http://file.medchemexpress.eu/product_pic/hy-p1163.gif)
![[8-L-arginine] deaminovasopressin](http://file.medchemexpress.eu/product_pic/hy-p4237.gif)
![d[Cha4]-AVP](http://file.medchemexpress.eu/product_pic/hy-p1390.gif)
![d[Cha4]-AVP TFA](http://file.medchemexpress.eu/product_pic/hy-p1390a.gif)
![[D-Trp11]-Neurotensin](http://file.medchemexpress.eu/product_pic/hy-p3057.gif)
![Dp[Tyr(methyl)2,Arg8]-Vasopressin](http://file.medchemexpress.eu/product_pic/hy-p3213.gif)
![[Tyr4]-Bombesin](http://file.medchemexpress.eu/product_pic/hy-w343750.gif)
![[Deamino-Pen1,Val4,D-Arg8]-vasopressin](http://file.medchemexpress.eu/product_pic/hy-p10046.gif)
![N-Acetyl [Leu28, Leu31] neuropeptide Y (24–36)](http://file.medchemexpress.eu/product_pic/hy-p10148.gif)
![[D-Phe12,Leu14]-Bombesin](http://file.medchemexpress.eu/product_pic/hy-103287.gif)
![[D-Phe12]-Bombesin](http://file.medchemexpress.eu/product_pic/hy-103282.gif)
![[Tyr1]-Somatostatin-14](http://file.medchemexpress.eu/product_pic/hy-p2545.gif)
![[Leu13]-Motilin](http://file.medchemexpress.eu/product_pic/hy-106323.gif)
![[Ala286]-Calmodulin-Dependent Protein Kinase II (281-302)](http://file.medchemexpress.eu/product_pic/hy-p10499.gif)
![[K15,R16,L27]VIP(1-7)/GRF(8-27)](http://file.medchemexpress.eu/product_pic/hy-p4195.gif)
![[K15,R16,L27]VIP(1-7)/GRF(8-27) acetate](http://file.medchemexpress.eu/product_pic/hy-p4195a.gif)
![[Ala11,D-Leu15]-Orexin B(human)](http://file.medchemexpress.eu/product_pic/hy-p1340.gif)
![[Ala11,D-Leu15]-Orexin B(human) TFA](http://file.medchemexpress.eu/product_pic/hy-p1340a.gif)
![[Des-His1,Glu9]-Glucagon amide](http://file.medchemexpress.eu/product_pic/hy-p1143.gif)
![[Des-His1,Glu9]-Glucagon amide TFA](http://file.medchemexpress.eu/product_pic/hy-p1143a.gif)
![[Ac-Tyr1,D-Phe2]GRF 1-29, amide (human)](http://file.medchemexpress.eu/product_pic/hy-p0211.gif)
![[DPro5] Corticotropin Releasing Factor, human, rat TFA](http://file.medchemexpress.eu/product_pic/hy-p3684a.gif)
